KEGG   Drosophila erecta: Dere_GG20435Help
Entry
Dere_GG20435      CDS       T01060                                 

Definition
GG20435 gene product from transcript GG20435-RA
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG20435
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG20435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 980 aa AA seqDB search
MSLSPNPNQYNPHVEHLNRTADSSQSYKLAYGYAMGDPRSYRCHDKLFSGSLNSLARRED
SSASDSEGKDKAKGSGTGLVGLQNIANTCYMNSALQALSNLPPMTHYFINCSDLVEYIAE
QSARRCKPGGLAKSYRRLMQDIWQDVDDPKEFIAPRGILYGIRTVHPMFRGFQQHDTQEF
LRCFMDQLHEELTEQVSMLPQTQNQPQYQSQSQPLQQQQQASETDDENESEVAPVSLTPA
SESEYDTCESSMSERSAEVLLKTEYFVTPCRTNGSNSGLPEGHTVHLQQAPLQHQQKNAS
SSEQKPVEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQT
HSLSVQSLNAAETSARTNEGWLSWMWNMLRSWIYGPSVTLYDCMASFFSADELKGDNMYS
CERCNKLRTGIKYSRVLTLPEVLCIHLKRFRNDLSYSSKISSDVYFPLEGFDMRPYIHKD
CKSEVAIYNLSSVICHHGTVGSGHYTCYARNALNGKWYEFDDQFVTEVPSELVQSCQAYV
LFYHKHNPQMKLVKDQAMTLSTSHPLCDSDIQFYITREWLSRLATFSEPGPINNQEMLCP
HGGILHSKADVISQIAVPISQPLWDYLYRTFGGGPAVNIIFECEICKRAAETLSRRQQYE
LNEFTKYNGLQNEFDSTAIYAIAMPWLRSWQQFSRGKTHKDPGPITNEGIAAPVESGTQN
GSATVSCVRLGSDYAQLNARLWRFLHNIYGGGPEIILRQALSDDDDAEEIEIIDQDDECD
EDEDQDQEEEDEEIPTASYQHNHSDTESNLGLRTTPSPSLSSSSSPSLTGKRQAMETESD
LRLNSPKSKRSRSKMKVSALRLNMRKRGKRNRSAFKQHAEMFGAKGNYNAHANAEPLVSE
KKDKDNDRTVAFPSEYSLPISIPFQSDNFQVNGVHEKSRDKGKLRNSSKSGNTAATKENV
TLQKFVTLREANGPSDETDI
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgagtcccaacccaaatcagtacaatccacatgtagagcacctcaaccgcacc
gctgacagcagccagagctacaagctggcgtacgggtatgccatgggtgacccgaggagc
taccgatgtcacgataaactcttcagcggatcgctaaattcgctggccaggcgagaggat
tcgagtgccagtgacagtgaaggcaaagacaaagccaagggctctggcacaggactcgtc
ggtctccagaacatagccaacacctgctatatgaactcggcactacaggctctgagtaac
ctgccgccgatgacccactacttcatcaactgcagcgaccttgtggagtacatagcagag
cagagcgcccgtcgctgcaagcccggcggactggccaagagctaccgccgcttgatgcag
gacatctggcaggatgttgatgatcccaaagagtttattgccccgcgtggtattctgtat
ggcattcgcacggttcatcccatgtttcgaggctttcagcagcacgacacccaggagttc
ctgcgatgctttatggaccagctgcatgaggagctgactgagcaggtctcaatgctgcca
cagacgcagaaccagccgcaataccagtcacaatcacagccactacaacagcaacagcag
gccagcgaaacggatgacgaaaacgagtctgaggtggcgccggtgtctttgacgcctgct
tctgagagcgagtacgacacctgtgaaagcagcatgtcggagcgatcggcagaggtgctg
ctaaagacagagtactttgtaacgccctgccggacaaatggttcgaacagtgggctgcca
gaaggacacacggtgcatttacaacaagctccgttgcagcatcagcaaaaaaatgcctcc
tccagcgaacagaaaccagtggaagcagcacgctctataatcagcgacgtgtttgacgga
aagcttttgtcctcggtgcagtgcctgacctgcgatcgcgtgtctacgcgcgaggagaca
ttccaggacctatcgctgcccattcccaatcgtgatttcctgaacgttcttcaccaaacc
catagcttaagcgtgcaaagtttgaatgccgctgaaacctcagctagaaccaacgagggc
tggctgtcctggatgtggaatatgctgcgttcctggatttacggaccctcagtgacgctc
tacgactgcatggccagttttttcagcgcggatgaattgaagggagacaacatgtacagt
tgcgaacgctgcaacaagctccggacgggaattaagtactcccgcgtactcaccttgcca
gaggttctgtgcatccacctgaagcggtttcggaacgatctttcttacagttcaaaaatc
tcgtcggacgtatactttccgctggagggctttgatatgcgaccttacattcacaaggat
tgcaagagcgaggtggccatttacaacctgtcttcggtgatttgccatcatggaacggtg
ggtagtggccactatacctgctatgcacgcaatgcgctgaacggaaagtggtatgagttt
gatgatcagtttgtgacggaggttccttcggagctggtgcagtcctgccaggcgtatgtt
ctgttttaccacaaacacaacccccagatgaagcttgttaaagatcaggcgatgactttg
tcgacttcacatcccctgtgcgattcggacattcagttctatataacccgggagtggctc
tcaagattggctactttttcagaaccaggacctataaacaaccaggagatgctgtgcccc
catggcgggattttgcattccaaggcagacgtgatcagccagattgcggtgccaatttct
cagccgctgtgggactacctctaccggaccttcggcggcggaccagcggtaaatataata
ttcgagtgcgagatctgcaagcgggcagcggagacgctttcccgccgtcaacaatatgaa
cttaacgagttcacaaaatacaacgggctacaaaacgaatttgattcgacggccatttat
gccatcgcaatgccatggctgcgctcctggcagcagttttcgcgcggaaaaacccacaag
gatccaggaccgattaccaatgagggcatcgctgctcccgtggaaagtggtacccaaaat
ggaagtgccactgtcagttgcgtgcgattgggctcggattatgcccaactgaatgcgcgc
ttgtggcggtttctgcataacatctatggtggtggtccggaaattatactccgacaggct
ctctcagatgacgacgatgctgaggaaatagaaatcattgaccaagatgatgagtgcgac
gaagatgaggatcaggaccaggaagaggaagacgaggagattccgacagcaagctatcag
cacaatcattccgacaccgaaagcaatttggggcttcgcacaactccgagtccaagtctc
agtagcagttccagtccaagcctaacgggcaagcgtcaggcgatggaaacggagtccgac
ctgcgactaaatagtccgaagtcgaagcgcagcaggtccaaaatgaaggtgtccgcgctg
cgtttaaatatgcgaaagagaggcaagcgcaatcgcagtgcctttaagcaacacgccgag
atgtttggagctaaaggaaactacaatgcccacgccaatgccgaacccttagtgtctgag
aaaaaggataaggacaacgaccgaactgttgcatttccgagcgaatatagcttacccatt
tccattccattccaaagcgacaattttcaggtgaacggcgtgcacgagaagtcacgcgac
aagggaaaactgaggaacagctcaaagagcggcaacacagctgccaccaaggagaacgtc
acgctgcaaaagttcgtgaccctgcgcgaggccaatgggccgagtgacgagactgatatt
tga

DBGET integrated database retrieval system