KEGG   Drosophila erecta: Dere_GG20615Help
Entry
Dere_GG20615      CDS       T01060                                 

Definition
GG20615 gene product from transcript GG20615-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dere_GG20615
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dere_GG20615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MSQGKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTL
REISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSL
PTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSV
VVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPT
EQQWPQTISVALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDY
FQQEPL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggggaagaagttcggcgatggcgatccgttcaactaccaggagctgaacatc
atcggcgaaggtgcctatggaacggtctacagagcccgggacgtgatcaccggcaacatt
gtggcgctgaagaaggtgcggatatccctgaacgagaacggagtgcccatgtccacgctg
cgggaaatctcgctgctgaagcagctgaatgccagcaatcatgcgaatattgtcaaactg
tacgaagtatgccagttcctggagcgcgatggccaactgctgattctgctggttttcgag
catgtggagcaggatctgtcggatctgatagataggctgcccaaatcgggcatgtcgcta
cccacaattcagcgcctttcgagggaactgctgaccggtgtggactttttacactcacat
cgcatcatccatcgggatctgaagccgcagaacctgctggtctcctcgcagggccacctc
aagatcgccgactttggcctggccaagacctacggatcggagatgaagctcacctccgtg
gtggtcaccttgtggtaccgcgcacccgaagttctcctcgcccagccctacaacagcacc
gtggacatctggagcgccgcctgcatcatcttcgagatgttcaaccgccgcgctctgttt
ccgggcacctccgagaagaatcagctggaccgcatcttcgaactcactggcagacccacc
gagcagcagtggccacagaccatttccgtggccctggaacactttccccagcggcatcca
aagagaccaaaagacttttgcccgcacctgtgcaagtacgccgatgatctgttgaataaa
atgctttcctacgacctccatctgcgaccatccgctttggcctgcttggagcacgactac
ttccagcaggaacccctatag

DBGET integrated database retrieval system