KEGG   Drosophila erecta: Dere_GG20663Help
Entry
Dere_GG20663      CDS       T01060                                 

Gene name
Dere_Amy-d
Definition
Amylase distal
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
der  Drosophila erecta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dere_GG20663 (Dere_Amy-d)
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dere_GG20663 (Dere_Amy-d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 494 aa AA seqDB search
MFLAKSIVCLALLAVANAQFDTNYASGRSGMVHLFEWKWDDIAAECENFLGPNGFAGVQV
SPVNENAVKDSRPWWERYQPISYKLDTRSGNEQQFASMVRRCNAVGVRIYVDVVFNHMAA
DGGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCGISNYNDANQVRNCELVGLRDLNQGNS
YVRDKVVEFLDHLIDLGVAGFRVDAAKHMWPADLAVIYGRLKNLNTEHGFASGSKAYIVQ
EVIDMGGEAISKSEYTGLGAITEFRHSDSIGKAFRGKDQLQYLRNWGTAWGFAASDRSLV
FVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFSDTDQGPPTT
DGHNIASPVFNSDHSCSGGWVCEHRWRQIYNMVAFRNAVGSDAIQNWWDNGSNQIAFSRG
SRGFVAFNNDNYDLNSSLQTGLPAGTYCDVISGSKSGSSCTGRTVSVGSDGRASISVGRA
EDDGVLAIHVNAKL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggccaagagcattgtgtgcctcgccctcctggcggtggccaacgcccagttc
gacaccaactacgcctccggtcgcagtggaatggtgcacctcttcgagtggaagtgggac
gacatcgctgccgagtgcgagaacttcctgggacccaatggcttcgccggcgtccaggtc
tcccctgtgaacgagaacgccgtcaaggacagccgcccctggtgggagcgctaccagccc
atttcctacaagctggacacccgctccggaaacgagcagcagttcgccagcatggtcagg
cgctgcaacgccgtcggagtgcgcatctacgtggacgtggtcttcaaccacatggccgcc
gacggaggcacctacggaacgggcggcagcaccgccagccccagcagcaagagctacccc
ggagtgccctactcctcgctggacttcaacccgacctgcggcatcagcaactacaacgac
gccaaccaggtgcgcaactgcgagctggtcggtctgcgcgacctcaaccagggcaactcc
tacgtgcgggacaaggtggtcgagttcctggaccatctgattgacctcggcgtggccgga
ttccgcgtggacgccgccaagcacatgtggcccgccgacctggccgtcatctatggccgc
ctcaagaacctgaacaccgagcacggcttcgcctcgggctccaaggcctacatcgtccag
gaggtcatcgacatgggtggcgaggccatcagcaagtccgagtacaccggcctgggcgcc
atcaccgagttccgccactccgactccatcggcaaggccttccgcggcaaggaccagctg
cagtacctgcgcaactggggcaccgcctggggcttcgccgcctccgaccgctccctggtc
ttcgtcgacaaccacgacaaccagcgcggacacggagcaggaggcgccgacgtgctgacc
tacaaggtgcccaagcagtacaagatggcctccgccttcatgctggcgcaccccttcggc
actccccgcgtgatgtcctccttctccttctcggacacggaccagggcccgcccaccacc
gacggccacaacatcgcctcgcccgtcttcaacagcgaccactcctgcagcggcggctgg
gtgtgcgagcaccgctggcgccagatctacaacatggtggccttccggaacgccgtgggc
tcggacgcgatccagaactggtgggacaacggcagcaaccagatcgccttcagccgcggc
agccgcggcttcgtggccttcaacaacgacaactacgacctgaacagctccctgcagacg
ggcctgcccgccggcacctactgcgacgtcatctccggctccaagagcggctcctcctgc
acgggcaggaccgtcagcgtcggatccgacggacgggcttccatctccgtcggccgcgcc
gaggacgacggagtcctggccatccacgtcaacgccaagttgtaa

DBGET integrated database retrieval system