KEGG   Drosophila erecta: Dere_GG20711Help
Entry
Dere_GG20711      CDS       T01060                                 

Definition
GG20711 gene product from transcript GG20711-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
der  Drosophila erecta
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:der00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 541 aa AA seqDB search
MNTYAGSILVLGALVASSLAASIDMPEIHNQFQLLGASVSAAKTRESNLIDPNAMAKGKL
GPEEEKSAQFWYDLAYEEIAKRLEQPQLDKRRAKNVILFLGDGMSLSTVAAARIHKGQLK
GNTGEEDSLSFERFPYTGLSRTYCSNAQVPDSACTATAYLCGVKTNIVALGVTAAVSFNN
CSGSEDPANQVDSIAAWAQAAGKATGIVTTTTLTHASPSGAYAKTTNRFFESDTDILTYG
EGKNDPATCTDIATQLITQAPGKNFDVMLGGGIGKFLPNTITDPFNKKGERSDGVNLLSR
WQGLHPGGVLAYNRNQLLKVNASRITNLIGTFRSGVMSFNKKADPKEEPTLAEMTRKAIE
MVSKRDDGYFLFVEGGLIDYGNHYNSPTYSLSETLQFEQAVQEALDITDPEETLIVVTSD
HAHPLTISGYPGRGTPILGLNQDYTDANGVKYATLNYAVGTNQYLDEHGQRIDLTDQIGA
EDFIHPSYIHGTVGVHAGDDVGIFATGPQSHLFTGVMQQSTIPHLMAYASCIGKGPTLCD
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttacgcaggcagtatcctggtgctgggcgccctggtggccagctccttggct
gcttccatagacatgcccgagatccataatcagttccagctgttaggagcatcggtgagc
gcagccaaaacccgcgaatcaaacctcatcgaccccaacgccatggccaagggaaagctc
ggaccagaggaggagaagagcgcccagttctggtacgatcttgcctacgaggagatcgcc
aagcggctggaacagccgcaattggacaagaggagggccaagaatgtaatcctgttcctg
ggcgacggcatgtccctgtccacggtggcagccgcccgcatccacaagggtcagctgaag
ggcaataccggcgaggaggactccctgagcttcgagaggttcccttacaccggtctgagc
aggacctactgctccaatgcccaggtgcccgactccgcctgcacagccaccgcttacttg
tgcggcgtgaagacgaatatcgtggctttgggagtgacggcggccgtgagcttcaacaac
tgcagtggcagcgaggatccggccaaccaggtggactccatcgcagcctgggctcaggca
gccggaaaggcgacgggaatcgtgaccaccaccacgctgacccatgccagtccatcgggt
gcctatgccaagaccaccaatcgcttcttcgagagcgacacggatattctgacctatggc
gagggaaagaatgatccggccacctgtacggacattgccacccaactgatcacccaggct
cctggcaagaacttcgacgtgatgctgggcggtggcattggcaagttcctgcccaacact
attacggatccgttcaacaagaagggcgagcgttccgacggtgtaaatctgctgtcccgc
tggcagggactgcatcccggcggtgttttggcctacaatcgcaaccagctgctgaaagtg
aatgcctcgaggatcaccaacctgattggcaccttccgctcgggagtgatgagcttcaat
aagaaggccgatcccaaggaggagcccacactggcggaaatgacgcgcaaggccatcgag
atggtcagcaagcgcgatgatggctacttcctgttcgtcgagggcggactcatcgattat
ggcaaccactacaactccccaacctattccctctcagagacgcttcagttcgagcaggcg
gttcaggaggctctggatataaccgaccccgaggagaccctgattgtagtcacctccgat
catgctcatccactgaccatctctggctatcctggcaggggtacccccatcctgggactc
aaccaggattacaccgacgcgaatggagttaagtacgccactctgaactatgcagtggga
accaatcagtatctggatgagcatggccagcgcatcgatctcaccgatcaaattggcgcg
gaagacttcatccaccccagctacatccacggcaccgttggcgtccatgctggcgatgat
gtgggcatctttgccactggtccgcagagtcatctcttcaccggcgtgatgcagcagagc
accattccgcatctgatggcctatgcctcctgcatcggcaagggtcccactctctgtgac
aattag

DBGET integrated database retrieval system