KEGG   Drosophila erecta: Dere_GG20758Help
Entry
Dere_GG20758      CDS       T01060                                 

Definition
GG20758 gene product from transcript GG20758-RA
Orthology
K14298  
mRNA export factor
Organism
der  Drosophila erecta
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:der03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPANPKDNFTFKC
HRSTGTTGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgccacacaatcgacaaaccggatgaatgacttcgaggtggcctcgccgccg
gacgactccgtctcggcgctggagttcagccccagtacggtgcagaagaacttcctggtg
gccggcagctgggacagcacagttcgctgctgggaagtggagcaaaacggggccaccgtg
cccaaatcgatgaagaccatgggcggacctgtgctggacgtttgctggtcggacgacggc
agcaaggtgttcgttgcgtcctgcgacaagcaggtgaagctctgggacttggcgtccgac
caggtgatgcaagtggcggcacacgatggtcccgtgaagacgtgccacatggtcaaggga
cccacatacacctgcctgatgaccggatcctgggacaagaccctaaagttctgggacaca
cgttcgcccaatcccatgatgaccatcaatctacctgagaggtgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacagccaacagaggactcatcatatattccctgcaa
aacagccccacggaatacaagcggcaggagagtccgctgaagtaccagcaccgcgccatt
tccatttttagggacaagaagaaggagcccacgggctgtgcgctgggcagcattgagggt
cgcgtggccatccagtatgtgaatccggcgaatcccaaagataacttcaccttcaagtgc
caccgctccacgggcaccacgggcttccaagacatttatgcagtgaatgacatcgcattc
catcctgtgcacggcaccctggtcaccgtcggttcagatggcaccttcagtttctgggac
aaagatgcccggaccaagctgaagtccagcgagaccatggatcagtccattaccaaatgc
ggatttaacgccaacggccagatctttgcgtacgccgtgggctacgactggtcgaagggc
cacgagtacttcaatccggccaagaagccccaaatcttcctgcgctcgtgctacgacgag
ctcaagccgcgcattaactga

DBGET integrated database retrieval system