KEGG   Drosophila erecta: Dere_GG20794Help
Entry
Dere_GG20794      CDS       T01060                                 

Definition
(RefSeq) GG20794 gene product from transcript GG20794-RA (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
der  Drosophila erecta
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dere_GG20794
   00053 Ascorbate and aldarate metabolism
    Dere_GG20794
   00500 Starch and sucrose metabolism
    Dere_GG20794
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dere_GG20794
   00860 Porphyrin and chlorophyll metabolism
    Dere_GG20794
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dere_GG20794
   00982 Drug metabolism - cytochrome P450
    Dere_GG20794
   00983 Drug metabolism - other enzymes
    Dere_GG20794
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dere_GG20794
Glycosyltransferases [BR:der01003]
 Others
  Hydrophobic molecule
   Dere_GG20794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 530 aa AA seqDB search
MQFPSVFGLLLVGILYSQLESTEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVT
AFTLAKEQLGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNHDFLKMLEIIGLKTT
EHALRQPKVQALINAEQKDGVFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQ
MMGLITPWSFVPHGFMPFTDRMSFLERVRNSYASFYEDMDRLLNYFPKMDAVTREFFGPV
LAEVPKVKHMEREISVMLLNSHAPLTTARPTVDAMVAVGGMHIYPPKPLPTDMQAFLDGA
TEGAIFFSLGSNVQSKDMPAEMLRLFLQVFGSLKQRVLWKFEDESISQLPENVMVRKWLP
QADILAHRNVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISLHFQ
SITEQILRHSLEQLIHNTTYKENVQRVSDIFRDRPQEPRKSAVYWIEYVIRHRGAPHMRS
AGLDLNWFQFYLLDVIAFVAIISLAGFMALSLAIRLLMGSNKKHKKAKQN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccatcagtatttggcctcctcctggttggaatcctgtattcccagttagaa
tcaactgagggatccaaaattctggctgtttatgcctttccgggaaaatcacattttatg
atgcacactgctttaataagggaacttgtggaaagtggtcatcaggtcaccatggtaaca
gcctttactctggcgaaagagcagcttggcagcaactacacggagatcttgatagaaccg
gtctacgatttctggcacgatgttaagctgaactttggagcccagcacttattcgagctg
acccgcatgaccaaccatgatttcctaaagatgctggagattatcggcctcaaaaccacc
gaacatgccctacggcagcccaaggttcaggcactcatcaatgccgagcagaaggatggg
gtttttgatctcctcctggccgaacagttctatcaggaggccttcttggctctggcacac
ctatataaaatacccgtggtgaccacgagcaccttgggctatgagaaccacatgagtcag
atgatgggcttgattacaccatggtcttttgtcccacacggctttatgcccttcaccgat
cgcatgagtttcctggaaagggtgaggaactcctacgcttccttctacgaagacatggac
aggctgctgaactattttcccaaaatggatgcggtgaccagggagttctttggacccgtg
ttggccgaggtgcccaaggtaaagcacatggagcgggaaatctcagtgatgctactgaac
agtcacgcaccactcaccacggcacgtcccacagtggatgccatggtggcagtgggtggc
atgcatatctatccacccaaaccgctcccgactgacatgcaagcctttttggatggcgcc
accgagggcgccatcttcttcagcctgggcagcaatgtccagagcaaggacatgcccgcg
gaaatgctgcgactgttcctgcaggtatttggttccctcaagcagagggtattgtggaaa
ttcgaggacgagagcattagccaattgccagaaaacgtgatggtcaggaagtggctgcca
caggcggacattctggcccatcgcaatgtgaaggtattcattacccacggtggtttgttt
ggcacccaggagggagtgcactacgctgtgcccatgctgggtatacccttctactgtgat
cagcacctcaatatgaacaaagctgttttgggtggatatgccattagtctacacttccag
tcgattaccgagcaaatcctccggcactccttggagcaactaatacataatacgacctac
aaagagaacgttcagagggtatcggatatttttcgggaccggccgcaggagccacggaaa
agtgccgtctattggatcgaatatgtcatccggcatcgaggtgcaccccatatgagatcc
gcgggcctggatctcaactggttccaattctacttgctggatgtcatagcatttgtggct
atcatttctttagctggattcatggccctctcattggccattagattactgatgggcagt
aacaagaagcacaagaaagctaaacaaaattaa

DBGET integrated database retrieval system