KEGG   Drosophila erecta: Dere_GG20891Help
Entry
Dere_GG20891      CDS       T01060                                 

Definition
GG20891 gene product from transcript GG20891-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
der  Drosophila erecta
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dere_GG20891
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dere_GG20891
Glycosyltransferases [BR:der01003]
 Polysaccharide
  Storage polysaccharide
   Dere_GG20891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 709 aa AA seqDB search
MRRQQSYRFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFM
IAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA
GRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGS
KNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacagcagtcctaccgcttcgaggacaatgagtccacctcttacgccctgagg
atgaatcgacgcttttcgagagtggagtccggggcggacctgaaggattatttcgatcga
ggtgacatcgcctcgcgggagaatcgctggaacttcgaggtggcatgggaggtggccaac
aaggtgggcggcatttacacggtgatccggtcgaaggcctatgtctccaccgaggagatg
ggtgagcagctgtgcatgatgggtccctacaaggagcactgtgcccgcaccgagatggag
gagatggagttccccaggggaaatcccctgctagatgctgtcaactccttgcgctcgcga
ggctataaaatccacaccggtcgttggctggtggacggcaatcctcaactgattctgttt
gatattggatccgccgcctggaagttggatcagtttaaatcggagatgtgggaaaagtgc
cacattggaatacctcatttggatatcgagactaacgatgccattatcctgggctttatg
attgccgaatttctggaggagttccgcaactttgccgtgacttattctcaaaacaatgaa
ctgagtgctccgaggattgtcgcccacttccacgaatggcaagctggcgtgggtctcatt
gtgctgcgcacacgtctggtggagattgccactgtgttcaccacccatgcaacattgttg
ggtcgttacttgtgcgccggcaacaccgatttctacaataacctggacaagttcgccgtg
gacgaagaggcgggcaagcgtcaaatctaccatcgctactgcctggagcgaggtgccacc
cacttggctcacgtgttcaccaccgtctccgagattacgggctacgaggcggagcatctg
ctgaagcgcaagccggacatcatcacgccgaatggattgaacgtgaagaagttctcggcc
atccacgagttccagaatttgcacgccgttgccaaggaaaagatcaacgaattcgtgcgg
ggtcacttctacggccacattgactttgatttggataagaccctgtacttctttatcgcc
ggtcgctatgagttcggaaataagggagccgacatcttcatcgaggcgctggcccgtctg
aatgcgatgctgaagcacgagaagccggacaccacggtggtggccttcctcatcttcccc
accaagaccaacaacttcaacgtggactcgctgcgaggacatgccgtgatcaagcagttg
cgagatacgatcaacaatgtccaacaggccgtgggcaagcgtatgttcgatacctgcctg
cagggcaacatccccaatgccgatgatctcctccagaaggatgacctggtcaagatcaag
cgttgcatgttcgccatgcagcgcgattcgatgccgcctgttaccacgcacaatgtggct
gatgactggaacgatccggtgctatcctcaatacgtcgttgccatctgtttaactcgcgc
cacgatcgcgtcaagatggtcttccatccggagttcctcacatccacaaaccctctgttt
ggaatcgattacgaagaatttgtccgtggctgccacttgggtgtcttcccctcatactac
gagccctggggttacactcccgccgagtgtacggtgatgggaattcctagcgtaaccacc
aatctgtccggtttcggctgcttcatggaggagcacataagtgatcccaagtcctacggt
atctacatcgtggaccgccgctatataggattggagaacagcgttcagcagctgtccagc
ttcatgatggagttctccaggctgaaccgtcgccagcgcatcatccagcgtaatcgcact
gagcggttgagcgatcttctggactggcgcaccctgggcatttactacagacaggccagg
gttaaggccctgcaggctgtttacccagactatgtggatgaattgtccctctatggatcg
aaaaacaacttgatcttctcgcgaccgcacagcgaacctcccagtcctacttcatcgcga
cacaccacaccagctccatcggtccacggttcggatgatgaggactccgtggatgaggag
accgagctcaaggaattgggcattaagtag

DBGET integrated database retrieval system