KEGG   Drosophila erecta: Dere_GG21301Help
Entry
Dere_GG21301      CDS       T01060                                 

Definition
GG21301 gene product from transcript GG21301-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
der  Drosophila erecta
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dere_GG21301
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dere_GG21301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MALKIRIAIIGQSNFAADVLELLLERSNIQIVGVFTIPDKGTREDILATTASIHNIPVFK
FASWRRKGVALPEVLEQYKSVGATLNVLPFCSQFIPMEVIDGALLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNVEPTDTLDTIYKRFLYPEGVKA
MRVAVDMVASGTAPKIIQAEVGATYDPAMFKTENQVINLQASAERIWNFVRGLDSVPGAI
ATVLHENGTEEQIRLFGAHLYSAGPVSDGKVLRLRGLTKPAWIHSRGLLIEGTDGAFVNI
RRIKRGTKVISASDWFRQSENQSITDFTEDELTKRTLLAGIWNAILKEEIDSSTDFFASG
AGSMDVVRLVEEVKEVFDVPLQNEQVFMAPVFEEFFSELVRFLRQGSACSSDQQLDFEAF
TLKANKRKIRVPTQLFINGEFVDAEGQRTLEIVNPTNEEVLCKVACASATDVDKAVQAAH
SAFYGPWKQITPRQRGQLMVNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACVAA
GNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHQLVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVKHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTVHGPQNHKAHLDKLLEFCRRGVDDGA
KLVYGGCRVPHLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFSGSDVDSLMERANR
TEYGLASGVFTKDIGKALSFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTVEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaaataagaatcgcaattataggacagagcaattttgctgctgatgttcta
gagcttttgttggagcgctcaaatatccaaattgtaggcgtcttcactattccagataaa
ggaactcgagaggacattttggcaactactgctagcatccacaacatacctgttttcaag
ttcgcaagctggcgtcgcaagggtgtggcactgcctgaggtcttggaacaatacaagtct
gtgggcgctaccctgaatgttttgcccttctgttctcaatttattcccatggaggtgatt
gacggggcgctattgggcagcatttgttaccacccgtcgatcttgcctcgtcaccgcgga
gctagtgccatatcgtggacactgatcgagggcgacgaggtggctggcttcagcattttt
tgggcagatgacggtcttgacacaggacccttgctgctaacccggcaaacgaatgtggaa
cccacggacacgctggacaccatatacaaacgcttcctataccccgaaggtgtaaaagca
atgcgtgtcgcagtggacatggtggctagtggtacggcacccaagataatccaggcggaa
gtgggggcaacctacgacccggctatgtttaaaacagaaaatcaggtgatcaatcttcag
gcctcagcagaaagaatttggaactttgttcgcggtctagactcagttcctggagccata
gccacggttttacatgagaatggcacagaggagcaaattcgactctttggagctcatctg
tactccgctggccccgtttcggatggaaaggttctacggctaaggggcctaacaaagccc
gcctggatacacagccgtggtcttcttatagagggaaccgacggtgcctttgtcaacatt
cgccgtattaagcgtggcacaaaggtaataagcgcgagcgactggtttaggcaatctgag
aatcagtctatcaccgactttaccgaggacgaattgacgaagcgaacgttgctggccgga
atttggaatgcaatactcaaggaagaaatcgactcatcgaccgatttctttgcatccggc
gcaggttcaatggacgtggtgcgcttagtggaggaggttaaagaagtcttcgacgtgccg
ctgcagaacgagcaagtttttatggcgcccgtattcgaggagttctttagcgaactggtt
aggtttcttcgacagggaagtgcctgttccagtgaccagcagctcgactttgaggcattc
acgttgaaagccaacaaaagaaagatccgagtgcccacgcaactttttatcaacggcgag
tttgttgacgccgagggtcaacgcactttggaaattgttaacccaaccaatgaagaagtg
ctttgtaaagtggcctgcgcctctgccacagacgtggacaaggcagttcaagcagcccac
tctgctttttatggaccctggaagcagataacaccaagacaacgaggccagttgatggtc
aatttggctgatctgatggaacgaaataaggaggagctagccactattgagtcagtcgac
tcgggagcggtttacactctagcccttaaaacccacgttggaatgtccatcgaagcgtgg
cgctactttgccggatggtgcgacaagatccagggcaacacgatccccgttaatcctgcg
agacccaacaatgtactgaccttcacccgtaaggagccaatcggtgtatgcgggttaata
acgccctggaactaccctctgatgatgctttcctggaaaatggccgcctgcgttgccgcc
gggaatacatgtctcataaagcctgcccagacctgcccgctgaccgctctgaagtttgca
gagttaactgtccgggccggatttccgccaggcgtgatcaatgtcctgcctggaaaaggt
tcagatgcaggacaggcagtggcagaccatcagctggtccgcaaactgggtttcaccggg
tccacgcccattggcaagcacattatgaagtcctgcgcagactccaaccttaaaaagtgc
tccctggagctggggggcaagagcccgctaattatcttcgctgattgtgatatggacaaa
gccgtcaaacacggcatgtcttcggtgttctttaacaaaggagagaactgcatcgccgcg
ggacggcttttcgtggaagatcggatacacgacgaatttatccgacgcgtccttaaggat
ctgcgcactatgaccatcggggacccacttgaccgctcgacggttcacgggcctcagaac
cacaaggcgcacttagacaaattgctggagttttgcagacgtggggtcgatgacggcgcg
aaattagtgtatgggggatgtcgagtcccacacctcaagggatatttcttcactcccaca
gtgttcacgaacgttacggacgatatgttcattgcccaagaggagtcctttggaccgatt
atgataatatcaaagttcagtggcagcgacgtagattccttaatggagcgggctaatcgc
acggagtatggtctggccagtggcgttttcacaaaggatattggcaaagcgcttagcttt
gctgatcgcattgaggccggcactgtgtttgtcaatgtatataataagactgatgtggca
gctccgtttgggggctttaagcaaagcggctatggcaaggatttgggtcaggaggcgctc
aacgagtacctaaagaccaagtgtgttacagttgaatactaa

DBGET integrated database retrieval system