KEGG   Drosophila erecta: Dere_GG21380Help
Entry
Dere_GG21380      CDS       T01060                                 

Definition
GG21380 gene product from transcript GG21380-RA
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
der  Drosophila erecta
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dere_GG21380
Enzymes [BR:der01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dere_GG21380
Transcription factors [BR:der03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dere_GG21380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3741 aa AA seqDB search
MGRSKFPGKPSKSINRKRISVLQLEDEAANPAEPQQPPPESQQPSGSGSGSPAAREKGNN
CDNDEDDNAPGGASTSGNTASSSAGSENSGNGSSSGSGSGSGSSGSGSTNGGSVNGGTHH
KSAANLDKEAVTKDQNGDGDKTKANASRSDASVSSAPSGKLSAAASGKALGKSPRTFSAS
ISGTSSGRSSGSSPEGNSGASSDGASSGISCGKSTAKSPDASSGTLSSGKLVKTTAAGTC
SSGKSSKASSGTTCEATTSGLSSACLKALFVATPATSTGLACALVSPGGSSQGGAFPISA
ALLRARKNSNKKFKNLNLARGEVMLPSTSKLKQLNSPVVDNPSPSAPIASGSPPSAEGGT
GVGGVVSPGEDAALKRVLSEMPNEVARDPSPSSCPAAPNGAVSGKGSAPNVPPAVATSAD
GSSPKSGADAGPSTLSTAAKQKKTVTFRNVLETSDDKSVVKRFYNPDIRIPIVSIMKKDS
LNRPLNYSRGGECIVRPSILSKILNKSSNIDKLNSLKFRSAAASSSSSNQESGSSSNLFG
LSRAFGAPMDEDDEGGVTFRRNDSPDDQNNAEDDEMEDDEDDEEADEDDDNEDDNDEAAS
EKSAETEKSVGVDERDSEEKQLVINSHFVLPKRSTRSSRIIKPNKRLLEEGAISTKKTLT
LGDSKAKNVFGAASSSAGSTTSSFSASASLKLGKDTFFNFGNLKPNSSAAGNFVLRQPRL
QFQADTQPAPFTAPKACPTSPSAIPKPANSLAPSSFGSLASTSASTVTPTPSACSVCSAM
VSSKEVAQARKYGVVACDVCRKFFSKMTKKSISANSSTANTSSGSQQYLQCKGSEGSSCS
IQSAKSQLKNFKKFYKDRCTACWLKKCMNSFQLPAAHRSRLSAILPPGMRGESSSREEKS
AELLSPTGSLRFTSTASSSSSSVVASTSVKWKSSGESTSALTSIKPNPLAENNVTFGSTP
LLRPAILEKPLFLKISNAADQKLTAAEAISPSLTKKTSKQEKEKAKESEQSEKPLSPTMA
ANKKSGAAEPPVAPEAQAQKEEAPQTSAATQPTAPSGTSQGVPQAEVAGETNATGDTLKR
QRIDLKGPRVKHVCRSASIVLGQPLATFGEDQQPEEGGDMQLEVAASVPSAISDPSPEKP
TQIVTDENDNCASCKTSPVGDESKPSKPSGSAQAEVKKVTAGGKEGTVSAAGGPSAKVTT
RNAAVASNLIVAASKKQRNGDIVTSSSVSQSSNQTQGRKTKEHRQQRTLISIDFWENYDP
AEVCQTGFGLIVTETVAQRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFE
DTTLMGSLLETTVNASTGPSASSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKN
YHSTCLGTSKRLLGADRPLICVNCLKCKSCSTTKVSKFVGNLPMCTGCFKLRKKGNFCPI
CQRCYDDNDFDLKMMECGDCAQWVHSKCEGLSDEQYNLLSTLPESIEFICKKCARRNESS
RIKAEEWRQAVMEEFKASLYSVLKLLSKSRQACALLKLSPRKKLRCTCGASSNQGKLQPK
ALQFSSGSDNGLGSDGESQNSDDVYEFKDQQQQQQQRNVNINKPRVKSLPCSCQQHISHP
QSFSLVDIKQKIAGNSYVSLAEFNYDMSQVIQQSNCDELDIAYKELLSEQFPWFQNETKA
CTDALEEDMFESCSGANYEDLQDAGGGSASVYNEHSTSQAESRSGVLDIPLEEVDDFGSC
GIKMRLDTRVCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVH
SAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDKSMYCPAHAKNGN
ALKANGSPSVTYESNFEVSRPVYVELDRKRKKLIEPARVQFHIGSLEVRQLGAIVPRFSD
SYEAVVPINFLCSRLYWSSKEPWKIVEYTVRTTIQNSSSTLTALDVGRNYTVDHTNPNSK
EVQLGMAQIARWHTSLARSEFLENGGADWSGEFPNPNSCVPPDENTEEEPQQQADLLPPE
IKDAIFEDLHQELFDGISMLDIFLHDDKTDLFAISEQSKDGTQAMTSNQAQNQQAGGAAS
VSICDEDTRNSNTSLGNGWPASNPVEDAMLSAARNSSQVQMLKTLAWPKLDGNSAMATAI
KRRKLSKNLAEGVFLTLSSQQRNKKEMATVAGVSRRQSISEASIEGVATTSGSVRSKSFT
WSAAKRYFEKSEGREEATKMRIMQMDGVDDSITEFRIISGDGNLSTAQFSGQVKCDRCQC
TYRNYDAFQRHLPSCGPTMSSNETESDVSGQGITNNATQISAESLNELQKQLLANAGGLN
YLQSATSFPQVQSLGSLGQFGLQGLQQLQLQPQSLGNGFFLSQPNPATQANTDDLQIYAN
SLQSLAANLGGGFTLAQPTVTAPAQPQLIAVSTNPDGTQQFIQIPQTMQATTTPTATYQT
LQATNTDKKIMLPLTAAGKPLKTVATKAAQQVAVKQRQLKSGHQVKPIQAKLQPHPQQHQ
QQQQTQVQQPITVMGQNLLQPQLLFQSSAQSQAPQLILPQAQPQNIISFVTGDGSQGQPL
QYISIPTAGEYKPQPQPTATPTFLTTAPGGGATYLQTDASGNLVLTTTPTNSGLQMLTAQ
SLQAQPQVIGTLIQPQTIQLGGGADGNQPGGNQQPIILGGTGGGSTGLEFATSSPQVILA
TQPMYYGLETIVQNTVMSSQQFVSTAMPGMLSQNASFSATTTQVFQASKIEPIVDLPAGY
VVLNNTGDASSAGTFLNAASVLQQQTQDDTTTQILQNANFQFQSVPTSSAASTSMDYTSP
VMVTAKIPPVTQMKRTNAQAKAAGISGVGKVPPQPQVVNKVLPTSIVTQPSQVQLKNSNL
KQSQVKGKAAAGTGTTCGAPPSIASKPLQKKTNMIRPIHKLEVKPKVMKPTPKVQNQNHS
VLQQQQQPQLQQQIPAVVVSQVPKVTISQQRIPAQPQQQQQQQQQLQQAQMLHIPQQQQP
LQQQQVQVQPSMPIITLAETPVLQSQFVPEPQVLEQQELASRVQHFPTSSTSSSSNCSLP
TNVVNPMQQQAPPTTSSSTTRPTNRVLPMQQRQEPAPLSNECPVVPSPTPPKPVEQPIIQ
QMTSASVSKCYAQKSTLPSPVYEAELKASSVLESIVPAVTMDAILEEQPVTESIYTEGLY
EKNSPAESKTEQLLLQQQQREQLTQQLANNGYLLDKHAFQVEPMDTDVYREEDLEEDDDE
DDDFSLKMATSACNDHEMSDSEEPAVKDKISKILDNLTNDDCTDSIATATTMEVESSAGY
QQMVEDVLATTAAASAPTEEFEGALETAAVEAAATYINEMADAHVLELKQLQNGVELELR
RRKEEQRTVSQEQEQSKAVIVPTAAAPEAPPPIQEPKKMSGPHLLYEIQSEDGFTYKSSS
ITEIWEKVFEAVQVARRAHGLTPLPEGPLADMGGIQMIGLKTNALKYLIEQLPGVEKCSK
YTPKYHKRNGNVSTAANGVHGGNLGGISASAALSLSGGDSHGLLDYGSDQDELQENAYDC
ARCEPYASRSEYDMFSWLASRHRKQPIQVFVQPSDNELVPRRGTGSNLPMAMKYRTLKET
YKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFK
IDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKF
PFEEEKIPCSCGSKRCRKYLN
NT seq 11226 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctccaagtttcccggcaaaccctccaagtccatcaaccgtaagcggatcagt
gtcctgcagctggaggatgaggcggccaatcccgccgagccgcagcagccaccgccggag
tcccagcagccgagtggctccggatctggttcgccggctgcccgggaaaagggcaacaat
tgtgataacgatgaggatgataatgcgccgggtggtgcctcaactagtggcaatacggca
tcctcatccgccggctccgaaaatagcggcaatggcagcagttccggatctggctccgga
tcgggatcatccggatcgggatctactaatggcggtagtgtaaatggcggcacccatcac
aagagtgcggccaatctggacaaggaggctgtgacgaaggatcaaaatggtgacggtgat
aaaacgaaagccaatgcttcaagatcggatgcatcggtgtcaagtgcaccctcaggcaaa
ttatctgcagcagcttctggaaaagccttgggcaagtcccccagaactttctcagcgtcg
atttctggaacatcctcaggacgatcgtctggctcctctccagaaggtaattccggggca
tcttccgatggagcatcttccggaatatcttgcggaaaatctacagccaagtcccctgat
gcatcctctggaacattatcttcgggaaaattggtcaaaacaacagccgctgggacatgc
tcttctggaaagtcttccaaagcatcttctggaacaacctgtgaagcaacaacctctggc
ctttccagtgcatgccttaaagcactattcgtggcgacaccggccacatcaactggattg
gcctgtgccctggtttccccaggaggatcctcgcaaggtggagcctttcctataagtgcc
gctttactgagagcacgcaagaatagtaataaaaagttcaagaatctaaacctggccagg
ggcgaggtaatgctgccctccacatccaagctgaagcagctcaatagtccggtggtggac
aatccgtccccctccgcgccaattgcctccggctccccgccctctgcggagggaggaacg
ggtgtagggggcgtggtcagcccgggtgaggatgcggccctgaagcgcgtcttgagtgaa
atgcccaatgaagttgcccgcgatccctctccatccagctgccctgcagcgccaaatgga
gcagtatcgggaaaaggatctgctcccaatgtgccgccagcagtggccacttctgctgac
ggcagtagtcccaaatctggagcggatgcgggaccatcgacgttatcaacggcggccaag
caaaagaagacggtgacgttcagaaacgtgctggagacaagtgatgataagtcggtggtg
aagcggttctacaatccagacatccgcataccaatcgtctcaattatgaagaaggattcc
ttaaaccgaccgctgaattactctagaggaggcgagtgcatcgtgcgaccctccattttg
tcaaagatactcaacaaaagctccaacatcgataagctgaactctcttaaatttcgatcg
gcggcagcgagctcatcttcctcaaatcaggagtcgggatcctcttcaaatttatttggt
ttatcgcgcgcttttggcgctcccatggatgaagacgatgagggtggtgtaaccttccgc
cgcaatgattctccagatgaccaaaacaatgcggaggacgacgaaatggaagatgatgag
gacgacgaagaagccgatgaggacgatgacaatgaggatgataatgatgaagcagcctcc
gaaaagagtgcagaaacagagaaaagcgtcggagttgatgagcgggattcggaggagaaa
caattggtcataaactcgcatttcgtgttgcccaaaagaagcacgcgatcttcgaggatc
attaagcctaacaagagattgctagaagagggtgccattagtaccaagaagactcttact
cttggcgactccaaagccaaaaatgttttcggagcagcttcctcaagtgcgggctccact
acatcgtccttctccgcgtcagcgagtctgaagctcggcaaggacaccttcttcaacttt
ggcaacctgaagccaaatagcagtgcagctggaaattttgtactgaggcaacctcgtctg
caattccaggcagacacccagccggcaccatttactgctccaaaagcttgccccacatca
cccagtgccattccgaaaccagcaaattcactggcgccttcgtcttttggatcactagcc
agcacaagtgcatcaacagtaacacctactcccagtgcctgctccgtatgctcagcgatg
gtcagcagtaaagaggtggctcaagcccgtaagtacggagttgtagcttgcgatgtgtgc
aggaagttcttctcaaagatgaccaagaaatcaatatcggccaattcgagcaccgctaat
acttcctccggcagccaacagtatctgcaatgcaaaggaagtgaaggatcatcttgcagc
attcaatctgccaagagccagttgaaaaacttcaagaagttttacaaggatcggtgcact
gcgtgttggctgaaaaaatgcatgaactcgtttcagcttcctgcggctcacaggagtaga
ttaagtgctatattgccaccgggtatgcgaggagaatcctcttcccgagaagaaaaatcg
gcggaactgctttctccaacaggcagcctgagatttacttctactgcgtcctcctcttcc
tcttcagtggttgcttctacgtctgtgaagtggaagtccagtggtgaatccacttctgcc
ttgacttcgataaagcccaatccactggcggagaacaatgtcacatttggcagtactcct
cttctgcgtccagcgattttggagaagcccctcttcctgaagataagcaatgcagcagat
caaaaacttacagctgctgaagcgatcagtcccagtctgactaaaaagaccagcaaacag
gagaaagagaaagcaaaggaatcggaacaaagcgaaaagcctcttagccccacaatggca
gccaacaagaaatccggagcagcagaacctccagttgctccagaagctcaagctcaaaaa
gaggaggcaccacaaacgtctgcagccacccagcctactgctcccagtggaacttctcaa
ggtgtaccccaagcagaagttgctggtgaaacaaatgctacgggtgacaccctgaaacga
caaaggattgatctaaagggacctcgagtaaagcatgtgtgtcgcagtgcctccattgtt
ctcgggcaacctttggctacctttggcgaggatcagcaacctgaggaaggtggagatatg
cagctagaagtagctgcttcagtgccatcagcaatttcggatccttcacctgaaaaacca
actcaaattgttacagatgagaacgacaattgtgctagctgtaaaacgtctcctgttggt
gatgaatcgaaacccagtaagccctctggcagtgcccaagctgaagttaagaaagtaaca
gcgggaggaaaagaaggaactgttagtgcagctggaggtccatctgcaaaggttacaaca
agaaatgcagcggttgcgtccaacctaatagtggcggccagcaaaaaacaacgaaacggg
gacattgttacctcaagttcggtcagtcaatcgtcaaatcaaacccagggacgcaaaact
aaggagcatcgacagcaacgtacactcatatccatcgatttctgggagaattatgatcct
gctgaagtttgccaaactggttttggtttgattgtaacagaaacagtggctcagagggct
ctgtgcttcctatgcggttccacaggcttggatccgctgatcttttgcgcctgctgttgc
gagccctatcatcagtactgtgtccaagatgaatataatctgaaacatggctcttttgaa
gatacgacgctaatgggcagcctccttgaaactacggtgaatgcctccactggaccatcg
gcatcttccctcaatcaactgacacagcgcttgaattggctgtgtcctcgatgcaccgtt
tgctatacctgcaatatgtcatcagggtccaaggtaaagtgccagaagtgtcaaaagaac
tatcacagcacctgcttgggcactagcaagagacttcttggagcagatcgtccgttaata
tgtgtcaattgcttaaaatgcaagtcttgctccaccacgaaagtatcgaaatttgttggt
aaccttccgatgtgtacgggttgctttaagttgcgcaagaagggcaacttttgtccaata
tgccagagatgctatgatgacaacgattttgatttgaaaatgatggagtgtggtgactgt
gcgcaatgggttcattccaagtgcgaaggtctcagtgatgaacagtacaatctattaagc
actctaccggagtcaatagagtttatctgcaagaaatgtgcccgcagaaatgagagttct
aggatcaaggctgaagagtggcgtcaggcagtaatggaggagtttaaagccagtctctac
agcgttctgaaacttctgagcaaatcccgacaagcctgtgcccttctcaaactaagtccc
cgcaagaaactgcggtgcacctgcggagcatcctcaaaccaaggtaaacttcaaccgaaa
gctcttcagtttagtagtggatcggataacggcttgggcagcgatggtgagtctcaaaac
agcgacgatgtctatgagttcaaggatcagcagcagcagcagcaacaacgtaatgttaac
ataaacaagccccgagtaaaatccctgccctgctcttgccaacagcacatcagccatccg
caatcttttagcctggtggatattaagcagaagattgctggcaactcgtatgtttccctg
gcggaattcaactatgacatgagccaagttatccaacagagcaattgcgatgagctggac
attgcctacaaggagctgttaagtgaacagtttccctggttccaaaacgaaacgaaagcc
tgcaccgatgccttggaggaggatatgttcgagtcttgctctggagctaactacgaggat
ttgcaagatgcgggaggaggaagtgcttctgtttacaacgagcattccacttctcaggca
gaatcgcgatctggagtgttggatattcccctggaggaagtggacgactttggtagttgt
ggcattaagatgcgattagataccagagtgtgtctcttctgcagaaagagtggtgaaggc
ttatccggcgaggaagcccggctcctgtactgcggtcatgattgctgggttcacaccaat
tgtgccatgtggtctgcggaagtgttcgaggagatagacggttcacttcaaaatgtccac
agtgcggtggccaggggaaggatgatcaagtgtacggtatgtggaaaccgcggagccacc
gttggatgcaatgtgcgatcttgtggcgagcactatcactatccctgtgccagaagcatc
gactgcgcctttctcacagataaatccatgtattgtcctgcccatgccaagaatggaaat
gccttgaaagccaatggatcgcccagtgtaacatacgaatccaactttgaggtttcccga
cccgtctatgtggaattagataggaaaaggaaaaagctgatagaaccagctcgtgtgcaa
tttcacattggatctttggaggtacgccagctgggagctatagttcccagattttcggat
tcctacgaagccgtggtgcccatcaatttcctgtgcagtcgtctgtattggtcttcgaaa
gagccctggaaaatagttgagtacacagtgcgcaccaccatacagaacagttcctccacc
ctaacagccctagatgtgggtcgaaattatacggtagatcacacaaatccaaacagcaag
gaggttcaattgggtatggcgcaaatcgctcgatggcacacaagtctagcgaggagtgaa
tttttggagaatggcggagccgactggagcggcgaattcccgaatcccaactcttgtgtg
cctcccgatgaaaataccgaagaggaaccgcaacagcaggctgatttgcttcctccagag
attaaggatgccatattcgaagatcttcatcaagagctattcgatggcatctccatgctg
gacatattcttgcacgatgataagacagacttgtttgccataagtgaacaatccaaggac
ggcactcaggcaatgacttccaaccaggctcaaaatcaacaagcaggtggagctgcttct
gtgagcatctgtgacgaggatacgcgcaattcaaatacgagcctgggaaatggttggcca
gccagcaatcctgtggaggatgcgatgttatccgcagcaagaaactccagccaagtgcag
atgctcaaaacactagcttggccaaagctcgacgggaatagcgccatggccacggctatt
aaaaggcgaaaactgtcgaaaaacttggcggaaggagtgtttttaaccctaagcagtcag
caaagaaacaagaaggaaatggccacagtggcgggcgtgtcaagaagacaatctatcagt
gaggcatctatcgaaggagtcgctaccacatctggatctgtgagaagcaaaagcttcacc
tggagtgcagcaaaacggtatttcgaaaagagcgaagggcgcgaggaagcaactaagatg
aggataatgcaaatggatggcgtggacgattcaattaccgaatttcgcataatttctgga
gatggaaatttatcaacagctcagtttagcggtcaagttaaatgtgatcggtgtcagtgc
acctacagaaactacgacgccttccagcggcatttaccatcctgtggtccaacaatgtcc
tccaatgaaacggaatcggacgtcagtgggcaaggcatcactaataatgctacccagatc
agtgcggaaagcttgaacgagctgcaaaagcaacttctagcgaacgcaggaggcttaaat
taccttcaatcggcaacatcgtttccccaagttcagagcctgggctccctgggacagttt
ggcttgcagggattgcagcagcttcaactacaaccacaatccctgggcaatggatttttc
ctttcccagccgaatccggctacccaggcaaacacggacgatttgcaaatctatgcgaac
tcattgcaaagtttggctgccaatctgggtggaggtttcacgctagctcaacctacggtg
acagctccagcacaaccccaattaattgctgtttccacgaaccccgatggcactcagcag
tttatccaaatcccccagacgatgcaggccacaacgacaccaacagccacctatcagacc
ctgcaggccacgaatacggataagaagataatgcttcccctgacggcagccggaaagccc
ctgaagacagtggccaccaaagcggctcagcaggtggccgtcaaacagaggcagttgaag
tcgggacaccaggtgaagccgattcaggccaagttgcaaccgcaccctcagcagcatcaa
cagcagcagcagactcaggtgcaacagcccatcactgttatggggcagaatctcctccag
ccgcagctgttgttccagagcagcgcccagagtcaggcgccgcagctaatcttgcctcaa
gctcaaccccagaacatcatttcgtttgtgactggagacggaagccaaggacagccactg
cagtacatctccatacctacagccggagagtataaaccccagccacagcccacggcaacg
cctactttcctgacaactgctcccggtggaggtgccacctatttgcaaacggatgcgagt
ggaaatttggtgctcactaccacacccacaaactccggattgcaaatgctgacggcgcaa
tctctacaagcgcaacctcaggtgataggtacgctcatccagccccaaaccattcagttg
ggaggaggagctgatggcaaccagcccggcggcaatcagcaacccataattttaggtggt
actggtggaggatccactggcctggaattcgccaccagttctccccaggtgattctcgcc
acacaaccgatgtactatggactggagacgatcgtccagaatacggtcatgtcgtcacag
cagtttgtttccactgcaatgcccggaatgcttagccagaatgccagcttctcagcaacc
actacacaggtgttccaggccagtaaaatcgaaccgattgttgatctgcccgctggttat
gtggtgctcaataacacaggagatgcatctagtgcgggcacgttcctaaacgcagccagt
gtgctgcaacagcaaacgcaggacgacacaacaacgcagatactgcagaacgctaacttc
cagttccagtcggtgcccacatcttcagcagcctccacatcaatggattacacctctcct
gttatggtcactgcgaagatcccgccagtaactcagatgaagagaactaatgctcaagcc
aaggcagcgggaatttcgggtgtgggcaaagtgccgccacaaccgcaggtggtcaacaag
gtgctgcccaccagtatagtcacccagccgtcccaggtacagttgaagaactctaatctc
aagcaatctcaggttaagggcaaagctgcggccggaacgggaaccacttgtggagcccca
cccagtattgcttcgaagcctcttcaaaagaaaaccaacatgattcgacccattcacaag
ctggaagtgaaacccaaagtgatgaagcctacgccgaaggtacaaaatcaaaatcactca
gtgttgcagcaacagcagcagccacagttgcagcagcagattccagccgtggtagtcagt
caggtgccaaaggttacgatctcacagcagcgaatccccgcacaaccgcagcagcagcag
cagcagcaacaacagctgcagcaggcgcagatgctccatattccgcagcaacaacaaccg
ctgcagcagcaacaagtacaggtacagccatcaatgcccattataacactcgctgagaca
ccagtactgcaatcacaatttgtgccggaacctcaagttttggagcagcaggagctggct
agccgcgtacagcatttccccacaagtagcaccagtagtagtagcaactgctcgttgccc
accaatgtggttaatcccatgcaacagcaagcaccaccaaccaccagcagctccacaacc
aggcctacaaatcgggtgcttccaatgcagcagcgtcaggaacctgctccgttgtccaac
gagtgtcccgtagttccgtcacccactcctccgaaacctgttgagcagcctataatccaa
caaatgaccagtgccagtgtgtccaagtgctatgcccagaagtcaacattaccgtcacca
gtttacgaggcggaactcaaagccagttcagttttggagagcattgtgccagctgtcaca
atggatgcaatcttggaggaacagccggttaccgagtccatttacacggagggactctac
gagaagaattcgccggcggagtccaagaccgaacagctacttctccagcaacagcaacga
gagcaactaactcaacaactggcgaacaacgggtatctgctcgataagcacgcctttcaa
gtggagccaatggatacggatgtctacagggaggaagatctcgaagaggacgacgacgag
gatgatgacttcagcttgaaaatggccacatcagcgtgcaacgatcacgagatgtccgac
agtgaagagccggcggtcaaggataagatcagtaagatactagacaacctgactaacgat
gactgtacagattcaatagccactgcgacgacgatggaagtggaatccagcgctggttac
cagcaaatggtggaggatgtcctggccaccactgcagcagcatctgctcccaccgaagag
tttgaaggagctctagaaactgcagctgtggaagcagctgccacctatatcaacgagatg
gccgatgctcatgtactggaacttaagcagctgcaaaatggagtggaactggagctcagg
agaagaaaagaagagcagcgaacggtgtcacaggaacaggagcaatccaaggccgtcata
gtgcccacagcagctgctccagaagcaccaccacccattcaagagcccaaaaaaatgagt
ggtccacatctgctttatgaaatccaaagcgaagatggctttacgtacaaatccagttcc
ataactgagatttgggagaaggtctttgaggcagtacaggtggccaggcgggcacatgga
ctcactccgctgccagagggtcctctggcggatatgggtggcatccagatgattggtcta
aaaacaaatgccctaaagtacctaatcgaacagttgccaggcgtggaaaagtgctcaaaa
tatactcccaagtatcacaagcgcaatggcaacgtgtccacagcggcgaatggagtacat
ggaggcaacttaggcggaatcagtgcatccgctgccctgtcgttgtctggtggagattca
catggtctgctcgactatggctcggatcaggatgaattgcaggaaaatgcttacgattgc
gctcgatgtgagccttatgctagccgcagcgagtatgatatgttcagttggttggcctct
agacatcgcaagcagcccatccaggtgttcgtccagccatctgacaacgagctggtaccc
aggaggggaactggtagcaatctaccaatggccatgaagtatcgaacgctaaaggagact
tacaaggattatgttggagtcttcagatcccatatccatggacgaggcctctactgcact
aaggacattgaagcgggtgaaatggttatcgagtatgccggcgagttgattcgctccaca
ctgacggacaaaagggagcgttactacgacagccgcggtattgggtgctatatgttcaaa
atcgacgataaccttgtagtggatgccacaatgcgtggcaatgcggcgcgcttcatcaat
cactgctgtgagccgaattgctactcgaaagtggtggacattttagggcacaagcacatc
atcatctttgcgctgcgccgaatcgtgcagggcgaggagcttacctacgactacaaattt
ccattcgaggaggagaagataccttgctcatgcggttccaaaaggtgtcggaagtactta
aattaa

DBGET integrated database retrieval system