KEGG   Drosophila erecta: Dere_GG21484Help
Entry
Dere_GG21484      CDS       T01060                                 

Definition
GG21484 gene product from transcript GG21484-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
der  Drosophila erecta
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dere_GG21484
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dere_GG21484
    2.7.1.82  ethanolamine kinase
     Dere_GG21484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 522 aa AA seqDB search
MATNLQKATIEEIRHAAARICRDYLTGPWKVVTPENLVVKRISGGLSNFLYYVSLPDLND
YDVLEEQKQQQVNVNVNEDVIAATSTLTNSSAGFTHDDESASKAVGVTLAATELVNNEDD
AASSAKQAHKRQRCDSDSRDSSSSKRLHAPKQEPREVLLRIYGQTHGDHALESMITESVV
FALLSERNFGPKLHGIFPGGRIEQYIPARALTTAELGEQRILMRVAEKMGEIHSLNIPMS
KEPDWIWNCMQRWVSGLESIVNGSVQTNTKSSVLKKQMELMRTFDYVHEIAWIRAIIDEG
EYPVVFCHNDLQEGNILMRQPTAGQNERTPRESISSLRSNFDETLGDSLDGNSNISDTET
NKSHSVSPLPCTELDTTNDSALDASFTADNEPDLIIIDFEYCAYNYRGYDLANHFIEWTF
DYTNPQFPYFYHNSNNCATVQQRRDFIVNYLKKYHDDENYNITGQELIKVDAEIQFFTML
SHLFWSLWSVINVTSAIEFGYWEYGIARILEYQRLKAAYQAK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaacttgcaaaaggcgaccattgaggaaattcgccacgcggccgcgcgtatt
tgccgagactatctaactgggccctggaaagtggtaactccagagaatttggtggtgaag
cgcataagtggcggtctgtcaaatttcttgtattacgtaagccttcccgatttgaatgac
tacgatgtgctggaagaacaaaaacagcagcaggtaaatgtcaacgtcaacgaagatgtc
atagcggccacctcaactctgaccaatagtagcgcgggtttcacacacgacgatgagtcc
gcttccaaggcggtgggcgtaacattggcggcgacggaattagtaaataacgaggacgac
gcagcgtcaagcgccaaacaagcacacaaacgtcagcggtgcgatagtgatagtcgagat
tccagttcttcgaaacgattgcacgcccccaagcaggaaccccgtgaggtcctactgcga
atttatggtcagacccatggtgatcacgcgctggagagcatgattaccgagtccgtggtt
ttcgccctactcagtgaacgaaacttcggacccaaactgcacggaatctttccgggcgga
cgaattgaacaatatattccggcacgcgctttgaccacagcagaattaggagagcaacga
atattgatgagagtggctgaaaaaatgggtgagatccacagtctcaatatacccatgtct
aaggagcccgattggatatggaattgtatgcagcgttgggtttccggtttagagagcatt
gttaacggcagtgtccaaacgaatactaaatcttcggtactgaagaagcaaatggaattg
atgaggacttttgactacgttcatgagatcgcctggattagggcgattatcgacgaagga
gaatatccagttgtgttctgtcacaatgatttgcaagaaggcaacattctaatgcgacaa
ccgacagctggacaaaacgaacggaccccccgagagtctatcagcagcctgagatccaac
ttcgatgaaactttgggtgatagccttgatggaaatagcaatatatcggacacggagact
aacaaatcacatagcgtgtcgcctttaccatgcaccgagttggacactacgaatgactca
gccctggatgccagcttcacagccgataatgagccggatcttattattattgactttgag
tattgtgcctacaactaccggggctatgatcttgccaatcattttattgagtggactttc
gattacaccaatccacagttcccttacttctaccacaattcaaacaactgcgcaactgtg
cagcagcggcgcgacttcattgtaaactatttaaagaagtatcacgatgacgagaactat
aatatcactggccaggagctgataaaggtagacgctgagattcagttctttacaatgctg
tctcatctgttctggagcctttggtccgttattaatgtcacatcggcgattgagtttggt
tattgggaatatggtattgctcgaattctggaatatcaacggctaaaggcagcttatcaa
gctaaataa

DBGET integrated database retrieval system