KEGG   Drosophila erecta: Dere_GG21496Help
Entry
Dere_GG21496      CDS       T01060                                 

Definition
GG21496 gene product from transcript GG21496-RA
Orthology
K11252  
histone H2B
Organism
der  Drosophila erecta
Brite
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG21496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaccgacaagaaaaagaagcgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggtatttcgtctaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgcattgctgccgaggcgtctcgtctggctcac
tacaataagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgcctgcttctg
cccggagagttggctaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system