KEGG   Drosophila erecta: Dere_GG21537Help
Entry
Dere_GG21537      CDS       T01060                                 

Definition
GG21537 gene product from transcript GG21537-RA
Orthology
K10739  
replication factor A2
Organism
der  Drosophila erecta
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dere_GG21537
   03420 Nucleotide excision repair
    Dere_GG21537
   03430 Mismatch repair
    Dere_GG21537
   03440 Homologous recombination
    Dere_GG21537
   03460 Fanconi anemia pathway
    Dere_GG21537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEALNARYRAEDYQSKGGAGGGAGASSGSGPIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactcatttggagatttcaatgccacacaaactgcgcccgctggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagatcgtggacgccccggag
ggcaacatcgagttgttcggcatgcagtacgcgatggcctgtgttgtggccatagtgcgg
aacatcgagacttcctcgaccaagatcacctacacgctggaggatcatagcggcagaatc
gatgcgcactactggctggaagagggcgacgctctgaaggcacccgaagtcatggtcaac
aactacgtgaaggtctacggcaccaccagatcgcaaggcggctctaagaccctgatgatc
ttcaagctgctgcctgttctcgatcccaacgaggtgtgcacccacctgctggaagcactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggtggtggtgcaggg
gcttcttccggctcaggccccatagctgatttcaccgcctcccagagctcggccattgtc
agtggactggagcccaagcagcaggccgtgttccaggccatcaagagcaatgtttccgag
gagggcatctcccgcaaggagctgaaagccaaattctcccacatcagcgactctgagttg
accaacattctggactttatgatttccgaaggacacatttattccagcattgacgcagac
cactttatttgcacaatgtaa

DBGET integrated database retrieval system