KEGG   Drosophila erecta: Dere_GG21537Help
Entry
Dere_GG21537      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10739  
replication factor A2
Organism
der  Drosophila erecta
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dere_GG21537
   03420 Nucleotide excision repair
    Dere_GG21537
   03430 Mismatch repair
    Dere_GG21537
   03440 Homologous recombination
    Dere_GG21537
   03460 Fanconi anemia pathway
    Dere_GG21537
DNA replication proteins [BR:der03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dere_GG21537
DNA repair and recombination proteins [BR:der03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dere_GG21537
   MMR (mismatch exicision repair)
     Dere_GG21537
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dere_GG21537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEALNARYRAEDYQSKGGAGGGAGASSGSGPIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactcatttggagatttcaatgccacacaaactgcgcccgctggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagatcgtggacgccccggag
ggcaacatcgagttgttcggcatgcagtacgcgatggcctgtgttgtggccatagtgcgg
aacatcgagacttcctcgaccaagatcacctacacgctggaggatcatagcggcagaatc
gatgcgcactactggctggaagagggcgacgctctgaaggcacccgaagtcatggtcaac
aactacgtgaaggtctacggcaccaccagatcgcaaggcggctctaagaccctgatgatc
ttcaagctgctgcctgttctcgatcccaacgaggtgtgcacccacctgctggaagcactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggtggtggtgcaggg
gcttcttccggctcaggccccatagctgatttcaccgcctcccagagctcggccattgtc
agtggactggagcccaagcagcaggccgtgttccaggccatcaagagcaatgtttccgag
gagggcatctcccgcaaggagctgaaagccaaattctcccacatcagcgactctgagttg
accaacattctggactttatgatttccgaaggacacatttattccagcattgacgcagac
cactttatttgcacaatgtaa

DBGET integrated database retrieval system