KEGG   Drosophila erecta: Dere_GG21586Help
Entry
Dere_GG21586      CDS       T01060                                 

Definition
GG21586 gene product from transcript GG21586-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
der  Drosophila erecta
Brite
Ribosome [BR:der03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dere_GG21586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 204 aa AA seqDB search
MLPIARGVYRGLATITRNSRGAFHTASAFRCKAETSTEGNDAAATEGEGEDSASGSAPDA
KDRSKAIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRITTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
ITYDVPFREYDYNEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctattgcacgtggagtttacagagggctagccaccattactcggaatagccgt
ggagcttttcacacggccagcgccttccgatgcaaagcggagacttcgactgagggaaat
gatgcggctgccacagaaggtgaaggggaggatagcgccagtggttccgcaccggacgcg
aaggatcgcagcaaggccatccccgtggagacctcgattcgatacttaaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacgcgaaagacgtgcattcgccagaaccgtatcacaaccgga
aatccttgtcccatttgccgtgatgagtacttggtactggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgttctcagctactcaaagacaggcctg
tgccaaaagagtcatttgcgactaatggtcgccgttcagcaggcccgcgactccggatac
ataacatatgatgtgcccttcagggagtatgattacaacgagtactacggccaggagcag
aagcagaaagcttaa

DBGET integrated database retrieval system