KEGG   Drosophila erecta: Dere_GG21586Help
Entry
Dere_GG21586      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
der  Drosophila erecta
Brite
Ribosome [BR:der03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dere_GG21586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 RecR TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 6548910
NCBI-ProteinID: XP_001974177
FlyBase: FBgn0113764
UniProt: B3NKZ9
Position
Unknown
AA seq 204 aa AA seqDB search
MLPIARGVYRGLATITRNSRGAFHTASAFRCKAETSTEGNDAAATEGEGEDSASGSAPDA
KDRSKAIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRITTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
ITYDVPFREYDYNEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctattgcacgtggagtttacagagggctagccaccattactcggaatagccgt
ggagcttttcacacggccagcgccttccgatgcaaagcggagacttcgactgagggaaat
gatgcggctgccacagaaggtgaaggggaggatagcgccagtggttccgcaccggacgcg
aaggatcgcagcaaggccatccccgtggagacctcgattcgatacttaaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacgcgaaagacgtgcattcgccagaaccgtatcacaaccgga
aatccttgtcccatttgccgtgatgagtacttggtactggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgttctcagctactcaaagacaggcctg
tgccaaaagagtcatttgcgactaatggtcgccgttcagcaggcccgcgactccggatac
ataacatatgatgtgcccttcagggagtatgattacaacgagtactacggccaggagcag
aagcagaaagcttaa

DBGET integrated database retrieval system