KEGG   Drosophila erecta: Dere_GG21619Help
Entry
Dere_GG21619      CDS       T01060                                 

Definition
GG21619 gene product from transcript GG21619-RA
Orthology
K13273  
phosphomevalonate kinase [EC:2.7.4.2]
Organism
der  Drosophila erecta
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dere_GG21619
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dere_GG21619
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.2  phosphomevalonate kinase
     Dere_GG21619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MLKIVLISGKRKCGKDFVSERLQRRLGSRSRIVRISEPIKSEWARKLQLDLDALLSDGPY
KEKYRRDMIVWSDEVRARDYGYFCRVAMEEALSRQQTPYILVSDVRRKNDIKWFRETYGA
EKVITLRLTSRPETRCARGWTFTAGIDDVPSECDLDDLADGFDFVLANDEELDQEAIDLL
LDKLQLQYR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaattgtactgatcagcggcaagcgaaagtgcggcaaggatttcgtatccgag
aggctgcagcggagactgggctcccgttcacgaatcgttcgaatctcggagcccatcaag
tcggagtgggctcgcaagctgcagttggacctggacgccctgctcagcgatggaccctac
aaggagaagtaccggcgcgacatgatcgtgtggagcgacgaggtgcgggcccgggactat
ggctacttctgtcgcgtggccatggaggaggcgctgagtcgccagcagacgccctacatt
ctggtgagcgatgtgcggcgcaagaacgacatcaagtggttccgggagacttacggggcg
gaaaaggtcatcaccttgcgactgacatcccgtccagaaacccggtgtgcacgtggatgg
accttcaccgctggcattgacgatgtcccctccgagtgcgatctggatgatctggccgac
ggcttcgactttgtgctggccaacgacgaggaactcgaccaggaggccattgaccttctg
ctggacaagctgcagctgcagtatcggtag

DBGET integrated database retrieval system