KEGG   Drosophila erecta: Dere_GG21777Help
Entry
Dere_GG21777      CDS       T01060                                 

Definition
GG21777 gene product from transcript GG21777-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
der  Drosophila erecta
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dere_GG21777
   00053 Ascorbate and aldarate metabolism
    Dere_GG21777
   00500 Starch and sucrose metabolism
    Dere_GG21777
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dere_GG21777
   00860 Porphyrin and chlorophyll metabolism
    Dere_GG21777
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dere_GG21777
   00982 Drug metabolism - cytochrome P450
    Dere_GG21777
   00983 Drug metabolism - other enzymes
    Dere_GG21777
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dere_GG21777
Glycosyltransferases [BR:der01003]
 Others
  Hydrophobic molecule
   Dere_GG21777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 529 aa AA seqDB search
MESQWNRWILLAVLGLALGQISQAAKVLVLFPHVNEGHFAVMRTLVTELANREHTIEVYT
GHGLGEPMDNVSETVTVEFPFWSELLNLAAPKGNLADLGRLPIAKLRQSLASVGARAMDH
FLAQEPIQKLLKMSYLEFDFDVILVDYFYTEALLALGALHQRPVVGIISTDFGSYMDAVQ
EALVPAACSPIDFERDQPEMGFSERLGNIRTCIARRKQFIDDHYGAQEQLVTKYFKLQSS
IPELQASQLSVLLLNSHVPLITPKVSIPQIVPAGGLHIRGPKELPWNVKRFLEEARPGAI
YVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQHAVPQIDI
LAHPRVKAFLTNGDLLNLQEGISRNVPILGLPLFQHEIRNMELAVRLGVGLQLQEGNVTT
ESLNWAVEKLLIESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIG
ISSCQLHLFDLFVFYAGIATLVVTLLAALSFAGIYIWNKKNNSKSTKVN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcaatggaatcgttggatcttactggctgttttgggactagccttggggcag
atttcacaggcagccaaggtcctggtactatttccccatgtcaacgagggtcactttgcc
gtgatgcggactctggtcacagaattggccaatcgagagcacacaattgaagtgtatacc
ggtcatggtttgggagaacccatggataatgtgtccgaaacggtgacagtggaatttccc
ttttggagcgagttactaaatctggcggcgcccaagggaaacctcgctgatcttggtcgc
ctaccgatagcaaaactccgccagtcattggccagcgttggagctcgggcgatggaccac
ttcctcgcacaggagcccatccaaaagctgctgaagatgtcctacctggagttcgatttc
gatgtgatcctagtggattacttctacacggaggctctgttggcacttggagctcttcat
cagcggcctgttgtaggaattatttccacggatttcggcagctacatggatgccgtacag
gaggctctggttcccgccgcttgttcacccatcgattttgagcgggatcaacccgaaatg
ggcttctctgagcggttgggaaatatccggacatgtattgctcgccgtaagcagttcatc
gatgatcattacggcgctcaggagcaattggtgaccaagtacttcaagctgcagagctcg
atccccgagcttcaggccagccagctatccgtgctgctgctcaatagtcatgtgccattg
ataactcccaaagttagtatcccacagattgttcccgccggtggacttcatattcggggt
cccaaggagctgccctggaatgtaaaacgcttcctggaggaggcgcgtcctggagccatc
tacgttcaactgggaaacgaacaggcttgtggccagttacccaaagaaaaactcgatacc
ctatttgccttcttctccgccagaaagcagagcataatctggacctgtcacgacgtcaag
accctggagggattgccaaagaatgtgatgatccagcatgctgtgccacagatagacatc
ctggcgcacccgagggttaaggctttcttaaccaatggagacctgttgaacctgcaggag
ggcatcagtcggaatgtgcccattctgggattgcccctattccagcacgaaattcggaac
atggagctagccgtgcgattaggagtgggtttacagctgcaggagggcaatgtgactact
gagtcattaaactgggcagtggaaaaactactcatcgagtcacacttccagttgaccatc
cgggatgtatccctggagttcagggaccgtccccttggcgctctggccagcgctctcttc
tgggtgaactacgtggcccggcacaagggaggatctgctctgaggacccgtggcattggg
atctcctcttgccagctgcacttgttcgacctcttcgtcttctatgccggaatagctact
ctagttgttaccttactggcggccctgagtttcgctggcatttacatttggaataagaaa
aacaattccaagtcaaccaaagtaaattag

DBGET integrated database retrieval system