KEGG   Drosophila erecta: Dere_GG21791Help
Entry
Dere_GG21791      CDS       T01060                                 

Definition
GG21791 gene product from transcript GG21791-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
der  Drosophila erecta
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dere_GG21791
Translation factors [BR:der03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dere_GG21791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEEHSGADANDSDYQEEPNFEDPPGFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPERLDKLKLVINKLFSNYGDIVNVVYPVDEDGKTKGYAFMEYKQASQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTFKVQSDLYNFINDPDTYDQYC
VAAETAPNCVQVGFWQNVLPEPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFFLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKDLDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGEQNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLGEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWADQKSRRIMLR
GHVDTDNLETDEVDEEIVEFLVKEEVTLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagaaaagcgaggagcactccggtgcggatgcgaatgatagcgattaccaa
gaggagccaaactttgaagatccgcccgggtttgtggacaacatcagtgatgaagacctg
ctgggcgacatgttggcacagcgcccctcggaggctgatggcgtcgagagcgtggttgtg
gtggacaacatccccaaggtggagccggagcgactggataagctgaagttggtcatcaac
aagctgttctcgaactacggcgatatcgtcaatgtggtctatccggtcgacgaggatggc
aagaccaagggctacgcctttatggaatacaagcaggccagccaggcggaggaggccgtc
aagaagctgaacaatcatcgcctagacaagaaccacacctttgccgtcaatctctttact
gatttccagaagtacgaaaacatccccgagaagtgggagccgccaaccgtacaaaccttt
aaggtgcagagcgacctatacaacttcatcaacgacccggacacttatgaccaatactgc
gtggctgcggaaaccgcgcccaattgcgtgcaggtgggcttctggcagaacgtgttgccc
gaaccctttgagctggagacccgcgaacgcttcaccgacacgttcgtcaagtggtcaccc
ttgggtacttatgttgtcaccttccacaaacccggcgtggccatctggggtggcagtagc
ttccagaagatccagaagttccctcatcctggtacccaatttgtggagttttcgccctgc
gagaattacctagtgacctacggacccacacccacgggccaaaagatcatcatctgggac
atccgcaccggagccgaaaagcgttcctttgttgccgatggcatgtcggttctttccatg
ttccgttggtcgcacgacgacaagtttgtggcccgcatgggagagaattcgatccacatc
tacgaaacaccctctttctttcttctggacctaaagtccatcaagattccaggcattcgc
ggcttctcttggtcccccacagacaacgtgatcgcctactgggtggaggagcagaaccaa
atacccgcccgcgttaccttaatggagatccccaagaagcgtgagatccgtaacaagaac
cttttccatgtggccgactgcaagcttcattggcaaaagtccggcgactatctgtgcgtt
aaggtggatcgctactcaaagttgaagaaggacaagaaggacctggacgtcaagtttctg
ggaatgttctacaacttcgagatcttccacatgcgcgaaaaggagattcccgttgactct
gtggagattcgcgagctcattctagcctttgcctgggagcccataggcaacaagttctcc
atcattcacggcgaacaaaactcgtcgaatgtaagcttctacgaggtcaacaagggcgtg
aagcccagtttggtgaagcgtctggaaaagaaatcttgcacgcatctgttctggtcgcca
cgcggtcagtttatcgtgatggcgaacctcaccatgggcaccttcgagtttgtggactcc
accaacgattacatcatcagcgcatcgcccgatcatttccgcgcctctgaggtcgagtgg
gatcccactggacgctacgttgtgactggagtgtcgtcatggaaggtgaaggaggacacc
ggcttcaacatgtacactttccagggccgcatcatcaagcgtaccatcctcaagaacttt
gtgcagttcttgtggcgccctcgtcctcccaccctgcttggcgaagagaagcagaaggag
atcaagaagaacttgaagaagtactacgctgcctttgagcaaaaggatcgcctgcgcctt
acccgtgcctccaaggagctgctcgagaagcgctcgcagctgcgcgagacctttatggag
tatcgcaacaagcgtatcgccgagtgggcggatcagaagagtcgtcgaatcatgctgcga
gggcatgtggacacagacaacttggaaactgacgaagtggatgaagaaattgttgaattt
ttagtcaaggaagaagtcaccctgctggagtag

DBGET integrated database retrieval system