KEGG   Drosophila erecta: Dere_GG21946Help
Entry
Dere_GG21946      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dere_GG21946
Peptidases [BR:der01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dere_GG21946
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dere_GG21946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 411 aa AA seqDB search
MYETYNCLRSVFFATLIPGTILLSWLTGLVGLRSLQACLVIFLLIFVVLPLIFRYSVTFQ
RGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRR
FKRELRVEEAVAQDPDQQLEPAPGNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPG
GTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMM
VFEYIANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYTNKLRFESDIHVMEFRQPIMIIHAEDDVVVPFNLGYRLYR
IALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQKFVENYRDTVY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagacttataattgcctaaggtccgttttctttgccacactcattcccggaacg
atcctacttagttggctaactggtctggtgggtctgcgatctctgcaagcttgtctggtg
atcttcttactgatcttcgtcgtcctgcccttgatctttcggtactccgtaacattccag
cgcggcatcctatttctgacatttattaagtatcccaaaggacttgatctcaccaagccg
gagagcgtgggactgtatgccacacggaacttctacataaccgtaaaggatcacgatcag
gacgaggatggagtgcgagttggtgtgtggcacgtcctgcccagcaatgcagtgcgtcgt
tttaagcgcgagctgcgcgtggaggaggcagtggcccaggacccggatcagcagctggaa
cctgcacctggcaacgaacgtgagctgaaggagctatcgccagccatacggtctgaattt
cccgttgtgctgccggaaaacgagcagctcttctatgagcgattgctgcggatgcccggt
ggcactgtggttctctatcttcacgggaacacagccagcagaggcagcggtcaccgttcg
gaggtgtataagctgctgaggaagctcaactaccatgtgttctccttcgactacagaggc
tatgccgactccgatcccgtgcccccgacggaggaaggcgttgtgcgcgatgctatgatg
gtgtttgaatacatagccaacaccacctccaatccgattgtggtgtggggtcattccctt
ggcaccggagtggccacgcatctctgcgccaaactagctagcctacgggaaagagctccc
aggggagtgatcctcgaaagtccgttcaccaacattcgggatgagatacgcatgcatccg
tttgccaaactctataagaacctgccctggttcaattttaccatttcgcaaccaatgtac
accaataagctgagatttgagtcggatattcatgtcatggagttccgacaacccatcatg
atcatccatgctgaggacgacgttgtagtgccgtttaatctgggctatcgtctgtatagg
atcgcattggatggtagaagtcgaacctcgggacccgtggagttccatcgctttggggcg
agccgaaagtatggacacaaatacctctgccgagcaccggaattgccgggactgatccaa
aagtttgtggagaactaccgggacaccgtatactag

DBGET integrated database retrieval system