KEGG   Drosophila erecta: Dere_GG22097Help
Entry
Dere_GG22097      CDS       T01060                                 

Definition
GG22097 gene product from transcript GG22097-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
der  Drosophila erecta
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:der00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 271 aa AA seqDB search
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAATSGTDLTVSKNSQQLKLEMLNMELA
SNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAK
AMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCN
KILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQK
INSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaaatggcagcggccagaatggcgagggtgccgcggat
gccgtggccgtagccacgattcccacgggcgaagcttccgccgccacctccggcaccgat
cttacggtctccaaaaacagccagcagctgaaactggaaatgctcaacatggagctggcc
agcaatggaagcggccacgagaagtgcacgttccaccacgacctggagctggaccataag
ccaccgacacgagaggccctcctcccggacatggcccgctcgtaccgcctgctattgggc
ggcctgggcgagaatcccgatcgccagggactgatcaagaccccggagcgggcggccaag
gccatgctgtacttcaccaagggctacgaccagagtctcgaggatgttctcaatggcgcc
gtgtttgacgaggatcatgacgaaatggtcgtggtcaaggacattgaaatgttctccatg
tgcgagcatcatctggtgcccttctacggcaaggtgtccattggttacttgccgtgcaac
aagattctcggactcagcaaattggcacgcattgtggaaatattttcgcgtcgcctgcaa
gtacaggagcgtttgactaagcagatcgcagtggccgtgactcaggctgtgcaacctgct
ggagtggcagttgtcgtagagggagtccacatgtgcatggtgatgcggggcgtgcagaaa
atcaacagcaaaactgttacctcaactatgctgggcgtattccgagacgatcccaagacc
cgtgaggaattcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system