KEGG   Drosophila erecta: Dere_GG22104Help
Entry
Dere_GG22104      CDS       T01060                                 

Definition
GG22104 gene product from transcript GG22104-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
der  Drosophila erecta
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dere_GG22104
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dere_GG22104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 280 aa AA seqDB search
MLKRKLNQQKDSLEDGEPTKSAPRQDSTSDFFAEPLWQKFYETEVRLNEALDKLAAPAST
PFIYNPIVYASQLHRDYLRLYMDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKVSMQLA
GPVDQPPAVHPKRPVTGLDCRIEEPSGVRLWELFLRLAGSMQIFSRQCFVHNFCPLAFFG
ADGKNITPSELTGPYKKQLRDLCLETLEEQLELLKPHVIVAVGEYVLSALKRLAYGKSHS
VLVLRLPHPSPRSANNTKWPEKAQAFLEENNLIRFMRNES
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaagttgaatcagcagaaggacagtctggaggatggggagcccacgaag
tctgcgcccaggcaggatagtacatccgatttcttcgctgagccgctgtggcagaaattc
tatgagaccgaagtcaggttgaatgaggcgctggacaaattggctgctcctgcaagcacc
ccgttcatctataacccgatagtgtatgcgtcccagctgcaccgcgactacttgcgtctt
tatatggacggtcccaagaagctggtatttgttgggatgaatccgggacccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacggtaaaggtgtcaatgcagctggca
ggaccggtggaccaacctcctgccgtgcaccccaaacgtcctgtcactggcttggattgt
cggatcgaggagcccagtggcgtgcgtctgtgggaactattcctccgattggcaggcagc
atgcagatcttctcccggcaatgcttcgtccacaatttctgtccgctggcgtttttcggc
gcagacggcaagaacataacacccagtgaacttactgggccctacaaaaagcagcttaga
gatctgtgcttggaaaccctggaggagcaactggagctgcttaagccccatgtcattgtg
gctgtgggggagtacgtcctcagtgcactgaagcgtttggcatacggcaaatctcactcc
gttctagtgctccgactgccgcatccgagtccgcggtccgccaataacaccaagtggccc
gaaaaggcgcaagcgtttttggaggagaacaacctaatccgattcatgcggaatgaatcc
tga

DBGET integrated database retrieval system