KEGG   Drosophila erecta: Dere_GG22104Help
Entry
Dere_GG22104      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
der  Drosophila erecta
Pathway
der03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dere_GG22104
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dere_GG22104
DNA repair and recombination proteins [BR:der03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Dere_GG22104
 Prokaryotic Type
     Dere_GG22104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG DUF4918 CTNNBL
Motif
Other DBs
NCBI-GeneID: 6552325
NCBI-ProteinID: XP_001979784
FlyBase: FBgn0114279
UniProt: B3P3G2
Position
Unknown
AA seq 280 aa AA seqDB search
MLKRKLNQQKDSLEDGEPTKSAPRQDSTSDFFAEPLWQKFYETEVRLNEALDKLAAPAST
PFIYNPIVYASQLHRDYLRLYMDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKVSMQLA
GPVDQPPAVHPKRPVTGLDCRIEEPSGVRLWELFLRLAGSMQIFSRQCFVHNFCPLAFFG
ADGKNITPSELTGPYKKQLRDLCLETLEEQLELLKPHVIVAVGEYVLSALKRLAYGKSHS
VLVLRLPHPSPRSANNTKWPEKAQAFLEENNLIRFMRNES
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgcaagttgaatcagcagaaggacagtctggaggatggggagcccacgaag
tctgcgcccaggcaggatagtacatccgatttcttcgctgagccgctgtggcagaaattc
tatgagaccgaagtcaggttgaatgaggcgctggacaaattggctgctcctgcaagcacc
ccgttcatctataacccgatagtgtatgcgtcccagctgcaccgcgactacttgcgtctt
tatatggacggtcccaagaagctggtatttgttgggatgaatccgggacccaatggaatg
gcccaaaccggaattccctttggcaatgtgcgcacggtaaaggtgtcaatgcagctggca
ggaccggtggaccaacctcctgccgtgcaccccaaacgtcctgtcactggcttggattgt
cggatcgaggagcccagtggcgtgcgtctgtgggaactattcctccgattggcaggcagc
atgcagatcttctcccggcaatgcttcgtccacaatttctgtccgctggcgtttttcggc
gcagacggcaagaacataacacccagtgaacttactgggccctacaaaaagcagcttaga
gatctgtgcttggaaaccctggaggagcaactggagctgcttaagccccatgtcattgtg
gctgtgggggagtacgtcctcagtgcactgaagcgtttggcatacggcaaatctcactcc
gttctagtgctccgactgccgcatccgagtccgcggtccgccaataacaccaagtggccc
gaaaaggcgcaagcgtttttggaggagaacaacctaatccgattcatgcggaatgaatcc
tga

DBGET integrated database retrieval system