KEGG   Drosophila erecta: Dere_GG22272Help
Entry
Dere_GG22272      CDS       T01060                                 

Definition
GG22272 gene product from transcript GG22272-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
der  Drosophila erecta
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:der00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:der00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:der00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:der00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:der04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MYGTWGVFLGGILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEQL
FQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVADRKRFPNGLNALSDHIHKQ
GLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFAEWDVDYVKLDGCYANISDMATGYPEFG
RLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQHCNLWRNWDDIDDSLESLMQIMDYFA
KNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWSIMAAPLIMSNDLAAVRPEI
KDILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGA
PYSIPFTVNELGLRNPKGYNVQDLYDASNKLGVFQSDSQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacgtggggcgtctttctgggcgggatcctcctgctgcaggttctgcaacta
tctatgggcctcgataatggcctggcactcaagccacctatgggctggatgtcctgggag
cgtttccgctgcattaccgactgtaaactgtatccagatgagtgcatcagtgaacagctt
ttccaacggcatgccgatctcctggtttccgaaggatatgcagatgctggctacgagtac
gtcatcatagatgactgctggctggagaagaatcgtgacaacgatacccagaagttggtt
gcggacagaaaacgctttcccaacggcctaaatgccttatccgatcatatccacaaacag
ggtctaaagtttggcttgtaccaggattacggcaccaacacctgcgctggttatcccgga
gtgatcaagcacatgaagctggacgcccagacctttgccgagtgggatgtggactacgtg
aagctggacggctgctatgccaatatcagtgacatggccacgggctatccggagtttgga
cgcctgctgaatgaaactggccgtccgatggtgtactcctgcagttggcccgcgtatcag
gaggatgctggagaaatgcccgactatgagtcacttaagcagcactgtaatctgtggcgc
aactgggacgacatcgacgactcccttgagtccctaatgcagatcatggactactttgca
aagaaccaggacaggatccagccacatggcggaccaggacactggaacgatcccgacatg
ctactgctgggaaactacggcttgagttacgatcaaagcaagctgcagatggccatttgg
tctattatggcggcgcctctaattatgtcaaatgatctggctgcagtgcgtcccgagatc
aaggatatactgcagaatcgtgcggtcattgctgtggaccaggatgagctgggcatccaa
ggccggcgtgttttgtcccgcaaccaaatcgaagtctggaaacgtcccattacgccagta
acgaagagcggacaccactcctatgccgtcgccttcgtcagtcgccgagatgatggcgct
ccctacagcatccccttcacggtcaacgagctcggactgaggaatcccaagggatataat
gtacaggatctgtacgatgccagcaataagttgggcgtcttccagtcggacagtcagttc
atcacgcgcgtcaatcccaatggcgtaactttctacaagtttacagcgttgtaa

DBGET integrated database retrieval system