KEGG   Drosophila erecta: Dere_GG22272Help
Entry
Dere_GG22272      CDS       T01060                                 

Definition
GG22272 gene product from transcript GG22272-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
der  Drosophila erecta
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dere_GG22272
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dere_GG22272
   00600 Sphingolipid metabolism
    Dere_GG22272
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dere_GG22272
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG22272
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dere_GG22272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 417 aa AA seqDB search
MYGTWGVFLGGILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEQL
FQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVADRKRFPNGLNALSDHIHKQ
GLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFAEWDVDYVKLDGCYANISDMATGYPEFG
RLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQHCNLWRNWDDIDDSLESLMQIMDYFA
KNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWSIMAAPLIMSNDLAAVRPEI
KDILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKSGHHSYAVAFVSRRDDGA
PYSIPFTVNELGLRNPKGYNVQDLYDASNKLGVFQSDSQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacgtggggcgtctttctgggcgggatcctcctgctgcaggttctgcaacta
tctatgggcctcgataatggcctggcactcaagccacctatgggctggatgtcctgggag
cgtttccgctgcattaccgactgtaaactgtatccagatgagtgcatcagtgaacagctt
ttccaacggcatgccgatctcctggtttccgaaggatatgcagatgctggctacgagtac
gtcatcatagatgactgctggctggagaagaatcgtgacaacgatacccagaagttggtt
gcggacagaaaacgctttcccaacggcctaaatgccttatccgatcatatccacaaacag
ggtctaaagtttggcttgtaccaggattacggcaccaacacctgcgctggttatcccgga
gtgatcaagcacatgaagctggacgcccagacctttgccgagtgggatgtggactacgtg
aagctggacggctgctatgccaatatcagtgacatggccacgggctatccggagtttgga
cgcctgctgaatgaaactggccgtccgatggtgtactcctgcagttggcccgcgtatcag
gaggatgctggagaaatgcccgactatgagtcacttaagcagcactgtaatctgtggcgc
aactgggacgacatcgacgactcccttgagtccctaatgcagatcatggactactttgca
aagaaccaggacaggatccagccacatggcggaccaggacactggaacgatcccgacatg
ctactgctgggaaactacggcttgagttacgatcaaagcaagctgcagatggccatttgg
tctattatggcggcgcctctaattatgtcaaatgatctggctgcagtgcgtcccgagatc
aaggatatactgcagaatcgtgcggtcattgctgtggaccaggatgagctgggcatccaa
ggccggcgtgttttgtcccgcaaccaaatcgaagtctggaaacgtcccattacgccagta
acgaagagcggacaccactcctatgccgtcgccttcgtcagtcgccgagatgatggcgct
ccctacagcatccccttcacggtcaacgagctcggactgaggaatcccaagggatataat
gtacaggatctgtacgatgccagcaataagttgggcgtcttccagtcggacagtcagttc
atcacgcgcgtcaatcccaatggcgtaactttctacaagtttacagcgttgtaa

DBGET integrated database retrieval system