KEGG   Drosophila erecta: Dere_GG22291Help
Entry
Dere_GG22291      CDS       T01060                                 

Definition
GG22291 gene product from transcript GG22291-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dere_GG22291
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG22291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 148 aa AA seqDB search
MWPTWLLVLLSLSLANGRQVGRCSLARQLYRYGMPYNELPDWLCLVEGESSFNTQAINPS
NVDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSNDIRYSIACAKYIRKQQGFS
AWVAWNNRCQGVKPNVNHCFRRRHRNSG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccacgtggctgctggtgctcctatcactatcactggccaatggaaggcaggtg
ggcagatgcagcttggcccgtcagctctatcgctacggaatgccctacaacgagctgccc
gactggctgtgcctcgtggagggcgagagctccttcaacacacaggccattaatccctcg
aacgtggatggatccgtggactggggtctgttccagatcaacgatcgctactggtgcaag
cctgcggatggtcgtccctccaacgatctctgtcgattgccctgccgcctgctgttgagc
aacgatatccggtattctattgcctgtgcgaaatacatcaggaaacagcaaggattctcc
gcctgggtggcttggaacaaccgatgtcagggtgtcaagcccaatgtgaatcactgtttc
cggcggcgccacagaaactcgggctga

DBGET integrated database retrieval system