KEGG   Drosophila erecta: Dere_GG22294Help
Entry
Dere_GG22294      CDS       T01060                                 

Definition
GG22294 gene product from transcript GG22294-RA
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG22294
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dere_GG22294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 471 aa AA seqDB search
MNAAGGGSGSQAAGAAGGNSSLSHNALLATASGATTMPMAQLADGWLELESDPGLFTLLL
KDFGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSI
FFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKVHTKGMSPENKGLAIGNTPELA
CAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGW
EDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL
QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADEND
RRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQHLLPSKKVSGQGAANRISKQS
TTASAGGSTAGASAATPKTQQQQAAAAKNGKSPSKTPGRRRKGRNKCRKRK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgctggaggaggtagtggctcccaggcggccggagcagcgggaggcaacagc
agtcttagccataatgcgctacttgcaacggcatcgggggccaccaccatgccgatggcc
cagttggcagacggttggttggagctggagtccgacccaggtctctttaccctgctactc
aaagatttcggctgtcacgatgtacaggtagaggaggtgtacgacctacagaaacccatc
gagagtccctatggtttcatatttctctttcgctggatcgaagagcggcgtgccagacgc
aaaattgtggagacaactgctgagatattcgtcaaggatgaggaggccatttccagcata
ttcttcgcacagcaggtagtccccaatagctgtgccacgcacgccttgctctcggtgctc
ttgaactgcaacgagaacaatctacagctgggcgacaccctcagtcgactgaaagtccac
accaaaggcatgagtccggagaacaagggtttggcgattggcaacactccggagctcgct
tgtgcccataactcccacgcaatgccgcaggctcggcgtcggttagaacggactggagct
ggcgtctccagctgccgcttcaccggtgaggcttttcactttgttagctttgtgcctatc
aatggacaactgtttgagctggatggtctgaaaccgtatcccatgaatcatggcggttgg
gaggatagcgaggattggacagacaagttccgacgtgtgatggcggagcgactgggaata
gctaccggcgaacaggacatacgcttcaacctcatggctgtagtgccagacaggcggatt
gccataactcataaacttaagatgctgcgcacaaaccaggcaatcgtgtccgggacactg
cagaaacttctaaaggccgacgaacagggcgaatcagggaacggagactcccaacgcccg
gatacacccaccacgttattagagccgagcgctttcaccgcacgggatctgcaatcgctt
ctcaagaacctggacacggaaatagccatcaacgagcagcacctggccgacgaaaacgat
cgaaggcatatgtttaaagtggacgccagtcgacgcacccataactacgataagttcata
tgcacgttcctctcgatgttggcccaccagggcgtcctgggcgagctggttagccagcat
ctacttccgtcgaaaaaggtcagtggccagggcgcagccaatcggatcagcaagcagagt
accaccgcaagtgcgggcggaagcaccgcgggagccagtgcagccacgcccaagactcag
caacagcaggctgcggccgctaagaatggcaagtcgccaagtaaaacgccgggcaggagg
cgaaagggacgcaacaagtgcagaaaacggaagtag

DBGET integrated database retrieval system