KEGG   Drosophila erecta: Dere_GG22560Help
Entry
Dere_GG22560      CDS       T01060                                 

Definition
GG22560 gene product from transcript GG22560-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
der  Drosophila erecta
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:der00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:der00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:der00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 716 aa AA seqDB search
MLKGVPTLAGRNLRLLTTQAQVLVHQRAKASAAEPVEEFDQETDLLKRARFGHTGKQLQQ
KIINEKKLRAPPLMNLVFANRKLSFYDTSSTPKTKEDNAKLSQRRHYSMRPHREQEQRNA
EDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMENLKKVHKLNNYETGSSAE
TQHLNRETFKAVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKSNTLGKLADYIP
QLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQ
EPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSG
GEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAM
SVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGG
MMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRY
ETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLE
QCHVPHNPKDRWGNLPVDEAENFGHSHVVEFLRSWAEKADLSNEECNTEAVTSKTQADEE
ICSTSDLETSPTTSPIPTPVESGSRAGSGRSSPVPSDAGSTASVGSSIDDKTKPGL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtgttcccacgctagccggtcgaaaccttcgtctactgacgacccaggca
caggtgctggtgcatcagcgcgccaaggcgtccgccgccgagcccgtcgaggaattcgac
caggagacggatctcttgaagcgcgccagattcggacacacgggcaaacagctgcagcag
aaaataatcaatgagaaaaaactgcgcgctccaccgcttatgaacttggtgtttgccaat
cgaaagttgtccttctacgataccagttccactccaaagaccaaagaggataatgccaag
ctcagtcagagacgccactattcgatgcggccccatcgcgagcaggagcagcgaaatgcg
gaggatgtgctattcgacatgttcgccagcgaggagacgggcctcatctcgatgggcaaa
ttcctggccgggctaaagaccaccggaattcgcaggaacgatccgcgagtgcgggaactg
atggaaaacttgaagaaagtgcacaagctaaataactacgagacgggctcttcggcggaa
acgcagcatctcaatcgggagaccttcaaggcagtggtggcccccaacattgtgctgatt
gccaaggcgttccggcagcagttcgtgatccccgactttacgagtttcgtcaaggacatc
gaggacatttacaaccgctgcaagagcaacacattgggcaagttggccgactacattccg
cagctagctcgctataatcccgattcctggggcctgagcatctgcaccattgatggacag
cgcttctccatcggcgatgtggatgtgcccttcacactccagagttgcagcaagccactg
acctacgccattgccctggagaagctgggccccaaggtggtgcactcgtatgtgggccag
gagccgagtggcaggaacttcaacgaactcgtcctggatcagaacaaaaagccgcacaat
ccgatgatcaacgctggtgccattctcacctgctccctgatgaacgccttggtgaagccg
gacatgacctccgctgagatcttcgactacaccatgtcctggttcaagcggctgtccggc
ggcgagtacattggctttaataacgccgtattcctgtccgaacgggaggctgccgatagg
aactacgccctgggcttctatatgcgggagaacaagtgcttccccaagcgcaccaatctt
aaggaggtgatggacttctacttccagtgctgctccatggagaccaactgcgaggccatg
tccgtgatcgccgccagtttggccaatggtggcatctgtcccaccaccgaggagaaggtg
ttccggccggaggttatccgggatgtgctctcaatcatgcactcctgcggcacgtacgac
tactccgggcagttcgccttcaaggtgggtctgccagccaagtccggtgttagtggcggc
atgatgctggtcatccccaacgtaatgggcatcttcgcctggtccccgcccctggatcac
ttgggtaatacagtgagaggacttcagttttgtgaggagctggtctccatgttcaatttc
catcgctacgacaacctgaagcatctgtccaacaaaaaggatccaaggaagcaccgctac
gagacaaagggtctgtccatcgtgaatctgctcttttcagctgccagcggagatgttacg
gccttgcgccgtcatcgtctctccggaatggatatcaccctggccgactacgatggtcgc
actgccctccatttggctgcctccgaaggacacttggagtgcgtcaagtttctgctggaa
cagtgtcatgtaccccacaaccccaaggatcgttggggcaatctgcccgtggatgaggcc
gagaactttggccacagccacgtggtggagttcctgcgctcctgggccgagaaggccgat
ctgtccaacgaggagtgcaacaccgaggcggtgaccagcaagacacaagcggatgaggaa
atctgcagcacaagcgacctggagaccagtccgaccaccagtcccattcccacgcccgtg
gaatctggatccagggcaggatctggacggtccagcccggtgccatcggatgcgggcagt
acggcgagtgtgggaagcagcatcgatgacaagaccaagccgggactataa

DBGET integrated database retrieval system