KEGG   Drosophila erecta: Dere_GG22574Help
Entry
Dere_GG22574      CDS       T01060                                 

Definition
(RefSeq) GG22574 gene product from transcript GG22574-RB (EC:3.2.1.52)
  KO
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
der  Drosophila erecta
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dere_GG22574
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dere_GG22574
   00603 Glycosphingolipid biosynthesis - globo series
    Dere_GG22574
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dere_GG22574
   00511 Other glycan degradation
    Dere_GG22574
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG22574
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dere_GG22574
Chaperones and folding catalysts [BR:der03110]
 Intramolecular chaperones
  Others
   Dere_GG22574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 704 aa AA seqDB search
MFLYGTVFDFSLCCQPGDTGDPIPNSSLRRRWMWMCHVLRYLYKMSLAVSLRRAMLVLLT
GAIFILTVLYWNQGVTKAQAYNEALERPHSHHDASGFPIPVEKSWTYKCENDRCIRVGHH
RKSAKRVSFISCSMTCGDINIWPHPTQKFLLSSHTHSFSVEDVQLHIETSHREVRKQLQL
AFDWFLKDLRQIQRLDYVGSSSESTVSESSSKSRHHADVEPAATLFGATFGVRKAGDLNR
IQVKITVLKSGDLNFSLENDETYQLSSLTEGHRLQVEITANSYFGARHGLSTLQQLIWFD
DEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMNRFHWHLTD
AQSFPYISRYYPELAEHGAYSESETYTEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWD
WGPKRGMGELAMCINQQPWSFYCGEPPCGQLNPKNNHTYLILQRLYEELLQHTGPTDLFH
LGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMARLKLANNGVAPKHVAVWSSALTNTKCL
PNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAACAPYRTWQ
NVYKHRPWERMRLDKKRRKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDD
HDMDIVPPDVFRRISLFRNRLVELGIRAEALFPKYCAQNPGECI
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtttttatatggaactgtcttcgatttttcattatgctgccagccaggcgacactgga
gacccaattcccaattccagcctgcgacgaaggtggatgtggatgtgccatgtcctacgc
tatctctataagatgtccttggctgtttcgttgcgccgagctatgttggtgctgctcacc
ggcgccatattcatcctgacggtgctctactggaaccaaggagtcaccaaggcccaggct
tacaatgaggcgctggaacgcccccacagccaccacgatgccagtggctttcccataccc
gtcgagaagtcctggacatacaagtgcgagaatgaccgatgcatccgggtgggccatcat
agaaaatccgccaagagggtctcgttcatcagctgctcgatgacgtgcggtgatattaac
atttggccgcaccccacccaaaaattcctgctcagctcccacacgcatagcttctccgtg
gaggatgtgcagctgcacatagagacgtcgcatcgcgaagtgcgcaagcagctccaactg
gcttttgactggttcctgaaggatctgaggcaaatccagcggttggactacgtgggtagt
tcatcagagtcgaccgtaagcgaatcctcttcgaagtcacgccaccatgcagatgtggaa
ccagctgccacgctctttggagccacctttggcgtgaggaaggctggggatttaaataga
atacaggtcaagatcaccgtgcttaagtccggagaccttaactttagcctggagaatgat
gaaacctatcagcttagctccctaaccgaaggccaccgcctgcaggtggagatcaccgca
aactcttacttcggagcccggcatggactgtctacgctgcagcaactgatatggtttgac
gacgaagatcacctgttgcacacgtatgccaatagcaaggtgaaggatgccccgaagttt
cggtatcgtggcctcatgctggacacctctcgccacttcttctctgtggagtccatcaag
cgtacgattgtgggcatgggcctggccaagatgaaccgcttccactggcacctcactgac
gcccagagtttcccttacatttcgcgctactatccagagctggctgaacatggagcatac
tcggagagcgagacgtacacggagcaagatgttcgcgaggtggccgagttcgccaagatc
tatggcgttcaagtcatacccgagatcgatgcgcctgcccatgcgggtaacggctgggat
tggggacccaagcgcggaatgggcgagctggccatgtgcatcaaccagcagccatggagc
ttctactgcggcgaaccgccgtgcggtcagctgaatccgaagaataaccatacctacctc
attctgcagcgcctctacgaggagttgttgcaacacacaggccccacggacctcttccac
ctgggcggtgacgaagtgaatcttgattgctgggcgcaatacttcaacgatacagatctc
cgcggattgtggtgcgatttcatgctccaggctatggccagactaaaactggccaacaat
ggagtagcgcctaagcacgtagctgtctggtcgagcgccctgaccaacaccaagtgtctt
ccaaacagtcaattcaccgttcaggtatggggcggcagcacttggcaggagaactacgat
ttgctggacaatgggtacaacgtaatcttctctcacgtggacgcctggtatctggactgt
ggcttcggtagctggcgggccactggagatgccgcctgtgctccataccgcacttggcaa
aatgtctacaagcacaggccgtgggagcgcatgcgattggacaagaagcggaggaagcaa
gtgctgggtggcgaagtgtgcatgtggaccgagcaggtggatgaaaatcagctggacaat
cggctgtggccccgaacagcagctctggcggagcgcttgtggaccgatcctagcgatgat
cacgatatggacatagtgccgccagatgtattccgcagaatctcactgtttcgaaatcgc
ctcgtcgaactgggcatccgggctgaagcgctgtttccaaaatactgtgcccagaatccc
ggcgaatgcatttga

DBGET integrated database retrieval system