KEGG   Drosophila erecta: Dere_GG22574Help
Entry
Dere_GG22574      CDS       T01060                                 

Definition
GG22574 gene product from transcript GG22574-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
der  Drosophila erecta
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:der00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:der00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:der00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:der00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:der00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:der04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 660 aa AA seqDB search
MSLAVSLRRAMLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSHHDASGFPIPVEKS
WTYKCENDRCIRVGHHRKSAKRVSFISCSMTCGDINIWPHPTQKFLLSSHTHSFSVEDVQ
LHIETSHREVRKQLQLAFDWFLKDLRQIQRLDYVGSSSESTVSESSSKSRHHADVEPAAT
LFGATFGVRKAGDLNRIQVKITVLKSGDLNFSLENDETYQLSSLTEGHRLQVEITANSYF
GARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIV
GMGLAKMNRFHWHLTDAQSFPYISRYYPELAEHGAYSESETYTEQDVREVAEFAKIYGVQ
VIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQLNPKNNHTYLILQR
LYEELLQHTGPTDLFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMARLKLANNGVAP
KHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGS
WRATGDAACAPYRTWQNVYKHRPWERMRLDKKRRKQVLGGEVCMWTEQVDENQLDNRLWP
RTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEALFPKYCAQNPGECI
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccttggctgtttcgttgcgccgagctatgttggtgctgctcaccggcgccatattc
atcctgacggtgctctactggaaccaaggagtcaccaaggcccaggcttacaatgaggcg
ctggaacgcccccacagccaccacgatgccagtggctttcccatacccgtcgagaagtcc
tggacatacaagtgcgagaatgaccgatgcatccgggtgggccatcatagaaaatccgcc
aagagggtctcgttcatcagctgctcgatgacgtgcggtgatattaacatttggccgcac
cccacccaaaaattcctgctcagctcccacacgcatagcttctccgtggaggatgtgcag
ctgcacatagagacgtcgcatcgcgaagtgcgcaagcagctccaactggcttttgactgg
ttcctgaaggatctgaggcaaatccagcggttggactacgtgggtagttcatcagagtcg
accgtaagcgaatcctcttcgaagtcacgccaccatgcagatgtggaaccagctgccacg
ctctttggagccacctttggcgtgaggaaggctggggatttaaatagaatacaggtcaag
atcaccgtgcttaagtccggagaccttaactttagcctggagaatgatgaaacctatcag
cttagctccctaaccgaaggccaccgcctgcaggtggagatcaccgcaaactcttacttc
ggagcccggcatggactgtctacgctgcagcaactgatatggtttgacgacgaagatcac
ctgttgcacacgtatgccaatagcaaggtgaaggatgccccgaagtttcggtatcgtggc
ctcatgctggacacctctcgccacttcttctctgtggagtccatcaagcgtacgattgtg
ggcatgggcctggccaagatgaaccgcttccactggcacctcactgacgcccagagtttc
ccttacatttcgcgctactatccagagctggctgaacatggagcatactcggagagcgag
acgtacacggagcaagatgttcgcgaggtggccgagttcgccaagatctatggcgttcaa
gtcatacccgagatcgatgcgcctgcccatgcgggtaacggctgggattggggacccaag
cgcggaatgggcgagctggccatgtgcatcaaccagcagccatggagcttctactgcggc
gaaccgccgtgcggtcagctgaatccgaagaataaccatacctacctcattctgcagcgc
ctctacgaggagttgttgcaacacacaggccccacggacctcttccacctgggcggtgac
gaagtgaatcttgattgctgggcgcaatacttcaacgatacagatctccgcggattgtgg
tgcgatttcatgctccaggctatggccagactaaaactggccaacaatggagtagcgcct
aagcacgtagctgtctggtcgagcgccctgaccaacaccaagtgtcttccaaacagtcaa
ttcaccgttcaggtatggggcggcagcacttggcaggagaactacgatttgctggacaat
gggtacaacgtaatcttctctcacgtggacgcctggtatctggactgtggcttcggtagc
tggcgggccactggagatgccgcctgtgctccataccgcacttggcaaaatgtctacaag
cacaggccgtgggagcgcatgcgattggacaagaagcggaggaagcaagtgctgggtggc
gaagtgtgcatgtggaccgagcaggtggatgaaaatcagctggacaatcggctgtggccc
cgaacagcagctctggcggagcgcttgtggaccgatcctagcgatgatcacgatatggac
atagtgccgccagatgtattccgcagaatctcactgtttcgaaatcgcctcgtcgaactg
ggcatccgggctgaagcgctgtttccaaaatactgtgcccagaatcccggcgaatgcatt
tga

DBGET integrated database retrieval system