KEGG   Drosophila erecta: Dere_GG22578Help
Entry
Dere_GG22578      CDS       T01060                                 

Definition
GG22578 gene product from transcript GG22578-RA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dere_GG22578
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG22578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 851 aa AA seqDB search
MAVKQNNSEPGDASDNAGGTGNGIPPNTKPMSSNGLKNAEENGVSKGMDTGSPAGESLNS
NRPGKRDIKALLAYLQSIDMPEQGHNVMAICERVIVDLARLHIPRGASCPRLKEDVCQVG
AFLATRNEKFHQMFYLRVVYELITKSPFEPPPSCAVAIVFQLFDSTQILEAVHSLLEQNV
QDSSIRKTVNLLCDWITYCTFCSTLNLWVLALLKGLRDQGKMALLDEIALDNIEKLFHVM
IFPALRQKAAPVVFHMLSTINQTPEVFHKILPRIPRVLQYVKNQSATMDEIGLETKKCLQ
QLVDLTSALMLRFYDQDELYVAAKKALQTYEPSPNCVALARAMHENAQPWGRRNARVGLV
NLGNTCYMNSVLQALAMTSDFSRQILLIECNSVLLMKVQQQIALMHHSLRYELTPSRVLN
ATRPPGFTPGLQQDSSEFLGYLLDLLHEHEINSSSATAHTVGPAKTSKDVDDVPALLSED
IFTSGVIPYNNKDHELSSGSSSDNCNHKPTPTPPATPTKGKNGLQQQGQQVTEGKPPSTI
DKTFAGKLSTTYRCLSCGWESRNEDSFRELQLSFPDDKEDCGATNYSVQDLIEYYCSPEK
LDGDNQYFCPQCKKLCDAERHIGVTQAPRNLILTLKQFKYDQKYHFRTKLMHKVFHDESV
TVKMSATDSLQETSTVHYDLYAGVVHAGYSMDSGHYFTFAADQAKNWYKFNDNVVTHSKP
EEMHNLTSPNTPYILFYKMCGHSNEANTDAASCSTSMGSGTNDQVVSVPLSPPLKLEELP
RRLRDYVRKDNHVYNEELRMQRFKRGSSGHGNGFVSRHTFDGDGDEDDKAPPPPGGCGSN
GLGMNINRFVY
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggccgttaagcagaacaacagcgagccgggagacgcctcggataatgccggaggaact
ggcaacggcatcccgcccaacaccaaacctatgtcttctaacgggcttaagaacgccgaa
gagaacggagtgtctaagggcatggacacgggatcgcccgctggcgagagcctgaattcc
aaccggccgggaaagcgggacattaaggccctgctggcatacctccaaagcatcgatatg
ccggagcaaggtcacaatgtgatggccatctgcgagagggttatcgtggacttggcccgt
ctgcacatcccccgaggcgcatcttgtccacgcctaaaggaagacgtgtgccaagtcggc
gcctttttggccacgcgcaacgagaagttccaccaaatgttctacctgcgtgtcgtctac
gagctgatcaccaagtctccgttcgagccaccaccctcgtgtgccgtggccattgtgttc
cagctgttcgactccacacagatcctggaggctgtgcactcgctgctggaacaaaatgtg
caggactcgagcattcgaaagacggtgaacctgctgtgcgattggatcacgtactgcacc
ttctgcagcactcttaatctttgggtcctcgcgcttcttaaaggtctgcgggatcagggc
aaaatggcgctgcttgacgagattgcactggacaacatcgagaagctgtttcacgtgatg
atcttcccggcgctgagacaaaaggccgctccggttgtgtttcatatgctgtcgacgatt
aatcagacgcccgaggtttttcacaaaatcttgccaaggatcccccgagtcctgcagtat
gtgaagaatcagtcggccaccatggacgagattggcctggaaaccaagaaatgtctgcag
cagctggtcgaccttaccagcgccctaatgctacgcttctacgatcaagatgagctttat
gtcgccgcaaagaaggccctgcaaacctatgagccctctccgaattgcgtggctctggcg
cgggcaatgcacgagaatgcccagccgtggggtcggcggaatgcgagggtcggactcgtt
aacctgggaaatacctgctacatgaatagcgtgcttcaggcgctagccatgaccagcgat
tttagcaggcaaatcctgcttatcgagtgcaattcagtgctgcttatgaaagtgcagcag
cagatcgccctgatgcaccactcgctacgctacgaactgacgccttcgcgagtgttaaac
gccacccgaccgcccggttttacgcccggccttcaacaggacagctccgagttcctagga
tatctgctcgacctgctgcacgagcacgagatcaacagctcctcagccactgctcatact
gttggtcctgcgaagaccagcaaggatgtcgacgacgtgccggcactgctgagtgaggat
atattcacaagcggcgtaattccgtataacaacaaggatcatgagctcagcagtggtagc
agcagtgacaattgcaatcacaagcccacgccgacacctcccgcgactcccaccaaaggc
aaaaacggcttacagcagcaaggccagcaggtgactgaagggaagccaccatctaccatc
gacaagacgttcgctggcaagctttccactacctaccgatgtctgagctgcggctgggag
agccggaacgaggacagctttcgcgaactgcagctgtcttttcccgatgataaggaagac
tgtggagctaccaactactcggtgcaggatctaatcgagtactactgctcgcctgagaag
ctggacggtgacaatcaatacttctgtccacaatgcaagaagctttgtgatgcggaacgg
cacatcggggtcacccaggcgcctaggaacctaattctcacgcttaaacagttcaagtac
gatcagaagtaccacttccgcaccaagctcatgcataaggtgttccacgatgagagcgtc
acagtaaaaatgtctgcaacggactcgctgcaggagacgtctactgtgcactatgacctg
tatgccggtgtcgtgcacgccggctacagcatggattccggccactactttacgtttgcg
gcggatcaagccaagaattggtacaagttcaatgataacgtggttacccattcgaagccg
gaggagatgcacaatctcacttcgcccaacacaccctacatcctgttctacaagatgtgc
ggccactccaatgaggctaatacggatgcggccagctgcagcacaagcatgggatcgggc
acgaatgaccaggtggtctcggtgccgctgtcgccgcctttaaagctggaggagttgccg
cggcgactccgcgactacgtaagaaaggacaaccatgtttacaacgaagagttaagaatg
cagcgctttaagcgtggcagcagcggtcacggcaatggatttgtcagccggcacacattt
gacggcgatggtgacgaagacgacaaggcgccgccgccgcccggaggatgtggaagcaat
ggactgggcatgaacatcaaccgcttcgtctactaa

DBGET integrated database retrieval system