KEGG   Drosophila erecta: Dere_GG22623Help
Entry
Dere_GG22623      CDS       T01060                                 

Definition
GG22623 gene product from transcript GG22623-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
der  Drosophila erecta
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:der04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 489 aa AA seqDB search
MMWRVAGVLLLGFIAISSAAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE
YAKAAELVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREAS
GIAKYMRAQVGPASKTVRTIAELTKFLDTKDTTLFGYFSDIDSNLAKVFLKFADKNREKY
RFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFEASSIKFEASSESELNTFVKENFHGLVG
HRTQDSIKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH
ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPFIKSEAIPE
SNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQNEEVAIVK
MDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDR
SGKPKKTEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcgcgtcgctggagtgctcctactgggcttcatcgccatctcatccgcagcg
gagcaggatgtcctggaattgggggacgacgacttcgccaccaccctaaaacaacacgag
acgacactggttatgttctacgccccctggtgcggccattgcaagcgattgaagcccgag
tacgcgaaggcggcggagcttgtgaaagacgatgatccgccaatcaaattggccaaggtt
gactgtacggaagctggaaaggaaacctgcagcaagtactctgtcagcggctacccaacg
ctgaagatcttccgtcaggatgaggtgtcgcaggactacaatggaccgcgtgaagctagc
ggcattgccaagtacatgcgcgcccaggtgggacccgcctccaagaccgtgcgcaccatt
gccgagctgaccaagttcctggacactaaggacaccacgctgttcggctacttcagcgac
atcgactccaatctggccaaggttttcctgaagttcgccgataagaaccgcgagaagtac
cgcttcggacactccagcgaaaaggaagtcctcgataaacagggcgaaaccgacaagatt
gtgctgattcgtgccccccatttgagcaacaagttcgaggcttcttctattaagttcgag
gctagctccgagtccgaattgaatacctttgtcaaggagaacttccatggtcttgtggga
caccgtactcaggattcgatcaaggacttccagaaccccttgatcactgcctactacagc
gtggactaccagaagaaccccaagggaaccaactactggcgcaaccgtgtgctcaaggta
gccaaggagtttgtgggtcaaatcaactttgcgatcgcctccaaggatgacttccagcac
gagttgaacgagtacggctacgatttcgttggcgacaagccagtggttttggctcgtgat
gaaaagaatctcaaatacgccctgaaggacgagttctcagtggagaacctgcaggacttt
gtcgagaagctgctggcgaatgagctggagccattcattaagagtgaagctattcccgag
tcgaacgacgcccccgttaaggtggccgtcgccaagaacttcgacgatctggttatcaac
aacggcaaggacacgctgattgagttctacgccccatggtgcggccactgcaagaagctg
actcccatctacgaggagctggccgagaagctgcagaacgaagaagttgccatcgtcaag
atggacgccaccgccaacgacgtgccgccggaattcaacgtgcgcggcttccccaccctc
ttctggctgcctaaggacgcaaagaacaagccagtgagctacaacggaggtcgcgaggta
gatgacttcctgaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgc
agcggcaagcccaagaagaccgagctctaa

DBGET integrated database retrieval system