KEGG   Drosophila erecta: Dere_GG22660Help
Entry
Dere_GG22660      CDS       T01060                                 

Gene name
Dere_epsilonTry
Definition
epsilonTrypsin
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
der  Drosophila erecta
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:der04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 256 aa AA seqDB search
MLKIAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRFGSHFCGGSI
YSHDIVITAAHCLQSVDAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNARTMVNDIAIV
RIESDLSFRSSIRAVRIADHNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIVDVSRC
RSGEFGYGKKIKDTMLCAYAPNKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYA
DVAHFHEWIEKTAREV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaatcgcagtacttctttccgttttggcttgcgccttggcaggcaccattccc
gatgggcttctgccccagttggatggccgtatcgtcggaggttacgagaccagcatcgat
gcccatccctaccaggtgtccttgcagcgctttggatcccacttctgcggtggatcgatc
tactcccacgacatcgtgatcaccgccgctcactgcctgcagtcggttgatgccaaggac
ctgaagatccgtgtgggcagcacctactggcgctccggcggcagtgtccactccgttcgc
tccttccgcaaccacgagggctacaacgcacgcaccatggttaacgacattgccattgtt
cgcatcgagtccgacctgagcttccgctccagcatccgtgcggtccgtattgccgaccac
aaccctcgtgagggcgccaccgccgtggtttccggctggggcaccaccgagtccggtggc
agcaccattcccgaccatctgctggccgttgatctggagatcgtcgatgtgtcccgttgc
cgctccggcgagttcggttacggtaagaagatcaaggacaccatgctctgcgcctacgcc
cccaacaaggatgcctgccagggtgactccggtggccctcttgtctccggcgaccgcctt
gtcggcgttgtgtcctggggctatggatgcggtgatgtgaggtaccccggtgtctacgcc
gatgttgcccacttccacgagtggatcgagaagaccgccagggaggtgtaa

DBGET integrated database retrieval system