KEGG   Drosophila erecta: Dere_GG22661Help
Entry
Dere_GG22661      CDS       T01060                                 

Gene name
Dere_alphaTry
Definition
alphaTrypsin
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
der  Drosophila erecta
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dere_GG22661 (Dere_alphaTry)
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dere_GG22661 (Dere_alphaTry)
Peptidases [BR:der01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dere_GG22661 (Dere_alphaTry)
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG22661 (Dere_alphaTry)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 256 aa AA seqDB search
MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSV
YSANIIVTAAHCLQSVSASSLQVRAGSTYWSSGGVVAKVAAFRNHEGYNANTMVNDIAVI
RLSSSLSFSSSIKAIALATYNPANGAAAAVSGWGTQSSGSNSIPSQLQYVNVNIVSQSKC
ASSTYGYGSEIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA
DVAVLRSWVISNANSI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagatcgtgatcctgttgtccgccgtggtctgcgccctgggaggcaccgtccct
gagggactcctgccccagttggatggccgcattgtcggcggctctgctaccaccatcagc
agcttcccctggcagatctccctgcagcgcagtggaagccactcctgcggtggatccgtc
tactctgccaacatcattgtgaccgccgcccactgcctgcagtccgtgtccgcctcctcc
ctgcaggtgcgcgccggatccacctactggagctctggcggagtcgtcgccaaggtggcc
gccttccgcaaccacgagggatacaacgccaacaccatggtcaatgacatcgccgtcatc
cgacttagctcctccctcagcttcagctcaagcatcaaggctattgccctggccacctac
aacccagccaacggagccgctgccgctgtttccggttggggtacccagtcctccggatcc
aactccatcccctcccagctgcagtacgtgaacgtgaacatcgtcagccagagcaagtgt
gcttcctccacctacggatacggtagcgagatccgcaacaccatgatctgtgctgctgcc
agcggcaaggatgcctgccagggtgactccggtggcccactggtctccggcggagtcctc
gtcggtgttgtctcctggggatacggatgtgcttactccaactaccccggtgtctacgcc
gatgttgctgtcctccgctcctgggtgatcagcaatgccaacagcatctaa

DBGET integrated database retrieval system