KEGG   Drosophila erecta: Dere_GG22715Help
Entry
Dere_GG22715      CDS       T01060                                 

Definition
GG22715 gene product from transcript GG22715-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
der  Drosophila erecta
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dere_GG22715
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dere_GG22715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 706 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVASGLVLLGLWTWAILIDTSAAAQPSAGLSSSERQQPQQSTG
YQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRFLRPTQAKKGPLPMSESF
LFEQERLKILEQQQRQRNAGMEELNANAEDERMLTSAERQTQYEHELQRMGVPVVAGIGP
DGPRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAH
NAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQPQ
SMALLEQVLTQVIELHSQCLGQATPASEVPVAPIRFTHIHIGCDEVQRMGECNSCRQRLR
SELFLSHVVSMAHFIRRQWPQLGVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYASDIY
RYIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRFSK
GLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQCVFQ
PDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLYDKLAEIGLYLQQTRDQSAW
LSDYNVRHNFSSPLRVRELTGRTPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQHIYP
TIEALQRQLARAEMLLQRRTWPQRPLPLPLKVQEDMGLVTHQQQPQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatctgtggatatttatttggcgccggaaactttccttcctactcgtcgcg
tctggcctggtgcttctcggcctctggacatgggccatactaatcgatacgtcagccgca
gcacagccctctgccggcctctccagttctgagcgccagcagccccagcagtccacgggc
taccagcaggttcacatcatccagaagctgatcgagcaggccaaccgggtgctgagagcc
gagcgactcaaggataacgccgtcgagaagtcgccttcgccagtccagcggctgggaaac
gtgcgattcctgcggcccacgcaggccaagaagggcccgctgcccatgtccgagagcttc
ctgttcgagcaggaacgcctcaagattctggagcagcagcagcgccagagaaacgccggt
atggaggaacttaacgccaatgcagaggacgagcgaatgctcacttcggcggagcgacag
actcagtacgagcacgagctccagcggatgggagtgccggtggtggctggcatcgggccg
gatggtccgagagctcccgccgagcgtctggtccatctggatctgaagggtgctccgccc
aagctcagcttcctcaagcaactgcttcccgtgctgcgggccctgggagccactggtctg
ctcatagagtacgaggacatgtttccctacagcggcgttctccagccgctggcggcgcac
aatgcctacaaggaggacgaactgcgggactttctggagtgcgctgccctacacgggctg
agtgtaatgcccctcgtccaaacgtttggtcacatggaatacgtgctcaaactgtctggg
tttgagcagctgcgagagctggccgagagtccacagtcgatttgccccagccagccgcag
agcatggcgttgctggagcaggtgctcacccaggtgatcgaactgcattcgcagtgcttg
ggtcaggcgacgcccgcctccgaagttcccgtggcgccaatccgattcacccacatccac
attggctgtgacgaggtgcagcgcatgggcgagtgcaacagctgccgccagaggctgcgc
agtgagctctttctctcgcacgtggtcagcatggcgcacttcatccgccgccagtggccg
cagcttggagtggtaatctgggacgaccagttgcgatcgatgtccctcagcgagctgcag
cactcgcaagtgggcagctacgtggagccgatggtgtgggtgtatgccagtgacatatac
cgctacatccagccgcagctgtgggatacctatgccaaggtctttcccagcgcctggacg
gcgtccgctttcaagggagccttcggcgagagcttgctggtgccgccgctgcagcatcat
cttgagaacaacatccgctggctggcagtgatcgccaaggaaggcgggcgcttctcgaag
ggattgcgagggctggccctgaccggatggcagcgttacgatcatttcgcagtactctgt
gaacttctaccggtaggcattcccagtctgatgacgtcgctgtccaccgtctccaagggc
tacttcagcactaatccgcgggacaatgagctgctgcgcgtgctgcagtgcgtcttccag
ccggacagtcggcgatcgggtcgaccctggttggaactacatccaaatgcccatcacagc
cagctctttgctgtctgcaactacccgggtcacctggttttcaaatatgccctgcgcctg
tacgacaagctggccgagatcggtctctatttgcagcagactcgtgaccagagcgcctgg
ctctccgactacaatgtgcgccacaacttcagctcaccgctaagggtgcgcgaactgact
ggcaggacgcccatgctgatcgaggagctgcgggccatggcgcgggaggcgcagcagctg
ctgtgggaggtgtacgatgagtacacggtgacggagtttgtggagcagcacatttatccc
accatcgaggcactgcagcgccagttggccagggcggaaatgctgctccagcgacgcact
tggccacagagaccacttcctctgcccttgaaagtgcaggaggacatgggactggtgacg
caccagcagcagccacaatga

DBGET integrated database retrieval system