KEGG   Drosophila erecta: Dere_GG22762Help
Entry
Dere_GG22762      CDS       T01060                                 

Definition
GG22762 gene product from transcript GG22762-RA
Orthology
K08738  
cytochrome c
Organism
der  Drosophila erecta
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dere_GG22762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 105 aa AA seqDB search
MGAGDAENGKKIFVQKCAQCHTFEVGGKHKVGPNLGGIVGRKCGTAPGYKYTDANIKKGI
NWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKTNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctggtgatgcggagaacggcaagaagatctttgtgcagaagtgcgcccagtgc
cacaccttcgaggtgggcggcaagcacaaggtgggcccaaatctgggcgggattgtgggt
cgcaagtgtggcacagcaccgggatacaagtataccgatgccaatataaagaagggcatt
aactggacagagggaaatttggatgagtaccttaaggacccgaagaagtacattcctgga
acgaagatggtgttcgcaggtctcaaaaaggctgaggagcgggccgatttgattgccttc
ctcaagacaaacaagtaa

DBGET integrated database retrieval system