KEGG   Drosophila erecta: Dere_GG22763Help
Entry
Dere_GG22763      CDS       T01060                                 

Definition
GG22763 gene product from transcript GG22763-RA
Orthology
K08738  
cytochrome c
Organism
der  Drosophila erecta
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:der00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcctgctggcgatgttgagaagggcaagaagctgttcgtgcagcgctgcgcc
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctgcatggtctg
atcggtcgcaagaccggacaggcggccggattcgcgtacacggacgccaacaaggccaag
ggcatcacctggaacgaggacaccctgttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaacgagcgcggcgatctgatc
gcctacctgaagtcggccaccaagtaa

DBGET integrated database retrieval system