KEGG   Drosophila erecta: Dere_GG22763Help
Entry
Dere_GG22763      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08738  cytochrome c
Organism
der  Drosophila erecta
Pathway
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dere_GG22763
   04215 Apoptosis - multiple species
    Dere_GG22763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 6547231
NCBI-ProteinID: XP_001976244
FlyBase: FBgn0114928
UniProt: B3NNJ3
Position
Unknown
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcctgctggcgatgttgagaagggcaagaagctgttcgtgcagcgctgcgcc
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctgcatggtctg
atcggtcgcaagaccggacaggcggccggattcgcgtacacggacgccaacaaggccaag
ggcatcacctggaacgaggacaccctgttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaacgagcgcggcgatctgatc
gcctacctgaagtcggccaccaagtaa

DBGET integrated database retrieval system