KEGG   Drosophila erecta: Dere_GG22773Help
Entry
Dere_GG22773      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
der  Drosophila erecta
Pathway
der00040  Pentose and glucuronate interconversions
der00053  Ascorbate and aldarate metabolism
der00830  Retinol metabolism
der00860  Porphyrin and chlorophyll metabolism
der00980  Metabolism of xenobiotics by cytochrome P450
der00982  Drug metabolism - cytochrome P450
der00983  Drug metabolism - other enzymes
der01100  Metabolic pathways
Module
der_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dere_GG22773
   00053 Ascorbate and aldarate metabolism
    Dere_GG22773
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dere_GG22773
   00860 Porphyrin and chlorophyll metabolism
    Dere_GG22773
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dere_GG22773
   00982 Drug metabolism - cytochrome P450
    Dere_GG22773
   00983 Drug metabolism - other enzymes
    Dere_GG22773
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dere_GG22773
Glycosyltransferases [BR:der01003]
 Others
  Hydrophobic molecule
   Dere_GG22773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 6547752
NCBI-ProteinID: XP_001976261
FlyBase: FBgn0114938
UniProt: B3NNL0
Position
Unknown
AA seq 526 aa AA seqDB search
MLKMIGMRCVLVLLLGVVATTQGANILGLFSSHSPSHLIIHMSVAKALVEAGHNVTVVSM
LQPKVMHKDIHLIVVPMKEEQERIMEGQMTEMAGQKNSLVSTMHRLLTSMDVMINAQAEL
LSDPRFQRIYETKFDLMILGYFINDFQLGVAHKLKVPVIIDWMSAPVPAIDMYTGNPSEM
SYVPVMGTVATHPMGILKRAENLVKSLFFDFIFVVFDYKLTRIYGEVFPEKDMPSLKQLR
KNISMAFVGSHLISEGPIRPLVPAVIEIGGIQVKDKPDPLPQDIDQFLSKSKQGAVFLSL
GSNIKSSTVRPEIVQTIFKVLSGLKENVIWKWEDLENTPGNASNILYKNWLPQDDILAHP
NTKLFITHAGKGGITEAQYHGVPMVALPIFGDQPANAAVMEKSGYGLALDLLSITEDSLR
DAVKEVLENQKYRQAIGQFSSLYRDRPLTAKQSVVFWTEYILRHHGAPNLQSPAVHMNFI
QLNNLDIYALILTILVLLGLLTRLVAKIVWNKFGGKARISQTKKKQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatgattgggatgcgctgcgtacttgtgttgctactcggagtggtggccacc
acccagggagccaacattttggggctcttcagcagccacagtccgtcgcatctcataatc
cacatgtcggtggccaaggcactggtggaggctggacacaatgtgaccgtggtgtccatg
ctgcagcccaaggtgatgcacaaggacatccacctgattgtggtgccgatgaaggaggag
caggaacgcatcatggaaggccaaatgactgaaatggccgggcagaagaactcacttgtc
agcactatgcatcgccttctcaccagcatggatgtcatgatcaatgcccaggcggagctc
ctctctgacccacggttccagcgcatttacgagaccaaattcgatttgatgattttgggt
tacttcatcaacgactttcaactgggggtcgcccacaagctaaaggtgccggtaatcatt
gattggatgtcggcacctgttccggcaatcgatatgtatacgggtaatccctcggagatg
tcctacgttccagtcatgggaactgtggccacgcaccccatgggcatcctaaagcgagct
gagaacctggtgaaatccctgtttttcgactttatatttgttgtgtttgattacaagttg
acacgcatttatggtgaggtctttccggaaaaagacatgccatctttgaagcagttgagg
aagaacatctccatggcctttgtcggctcccacttaatcagtgaaggacctattcgaccc
ctggtgcctgccgttatcgaaatcggtggcatacaagtgaaggataagccggatccgctg
cctcaggatatcgatcagttcctaagcaagtccaagcaaggtgctgtctttctctccctc
ggctccaatatcaagagctccactgtcaggccagaaattgtgcagaccatcttcaaggtc
ctgtctggactcaaggagaacgttatctggaaatgggaggacttggagaacacacccggt
aacgcctccaatatcctttataagaactggctgccccaagatgatatactggcccatcca
aacacgaaactctttatcacacacgcgggaaagggcggcattacggaggcccaataccat
ggcgtgcccatggtggctttgccaatctttggagatcagcccgcaaacgctgcagtgatg
gagaaatctggttatggcctggcactggacctgctgtccataacggaggacagtctaagg
gatgccgtgaaagaggttcttgaaaatcaaaagtacagacaggctatcggccaattctcc
tcgctgtacagagatcgacccttgaccgccaagcagtcggtggtcttctggaccgagtac
atcctgagacaccatggagcacccaacttgcagagtccagcggtgcacatgaatttcata
cagcttaacaatctggatatttacgccttgattctgacgattttggtcttattggggctt
cttacccgactagttgcgaaaatcgtgtggaacaaatttgggggaaaggcaaggatttcg
cagacgaaaaagaagcaataa

DBGET integrated database retrieval system