KEGG   Drosophila erecta: Dere_GG22822Help
Entry
Dere_GG22822      CDS       T01060                                 

Gene name
Dere_Dox-A3
Definition
GG22822 gene product from transcript GG22822-RA
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
der  Drosophila erecta
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:der00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:der00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 683 aa AA seqDB search
MADKKNLLLLFDHPTEPVFMDKGGNGTVFDVPASYVTDRYNKMCKKVQRRVSGGFEKNVL
VKEIPIPDLSCSMRLGRSEQFSLFLESHRQMACHLIDVFIKMPTVDELQSVAVYARDRVN
PVLFNYALSVAMLHRSDTKDLGLPAFAQIFPDRFIDSQMLRTMREESFVVERSAARLPVH
SSVKYTASDLDVEHRLWYFREDLGVNLHHWHWHLVYPNTAPDRSIVDKDRRGELFYYMHQ
QIIARYNAERLCNHMARVQPFNNLEEPIAEGYFPKMDSLVASRAFPPRFDNTRLSDVDRP
INQLRVGIDDMKRWRERIYEAIHQGYVLDANHKKIVLDDVKGIDILGNIIESSQLTPNKT
LYGDLHNKGHILIAFSHDPTNKHLEYAGVMGDASTAMRDPIFYKWHAFIDNLFQEHKRQL
SPYTEEDLTFPDVRVQSIQVESQGQVNRLTTFWQESDVDMSRGLDFVPRGHVLARFTHLQ
HHPFSYTIEVENSSEATRYGYVRIFLAPKLDDGNATMLLEQQRRMMVELDKFVVTMPPGS
HTITRDSTESSVTIPFKRTFRNMDNPGEPQNFLCGCGWPQHMLIPKGRAEGLSFELFVMV
SNYEDDKVDQKPEDCECSIAASYCGLRDRLYPDRKSMGFPFDRQPRSGSELLEKFLTPNM
CSIEVIISHEARTEKIPELPDHS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagaagaatctcctcctgctgttcgaccatcccacggagcccgtgttcatg
gacaagggaggcaatggcaccgtgttcgatgtgcccgcctcctacgtgaccgatcgctac
aacaagatgtgcaagaaggtccagcgacgcgtcagcggcgggttcgagaagaatgtcctg
gttaaggagatccccatcccggatctcagctgctccatgagactgggccgttcggagcag
ttctcgctcttcctggagtcccaccgccagatggcctgccacctgatcgatgtcttcatc
aaaatgcccaccgtggatgagctgcagagcgtggcggtgtacgccagagatcgtgtcaac
ccggtgctcttcaactatgccttgtcggtggccatgctccatcgatcggacaccaaggac
ctgggtctgcccgccttcgcgcagatcttcccggatcggttcatcgactcgcagatgctg
cgcactatgcgcgaggagtcctttgtggtagagcggtccgctgcccgcctgcccgtccat
agttcggtcaagtacaccgcctccgatcttgacgtggagcaccggctgtggtacttccgc
gaggacctgggcgtcaacctgcaccactggcactggcatctggtctatcccaacacggct
cccgaccgcagcatcgtggacaaggatcgtcgtggcgagctgttctactacatgcaccag
cagatcattgcccgctacaatgccgagaggctgtgcaaccacatggcccgtgtgcagccg
ttcaacaacctggaggagcccattgccgagggctacttccccaagatggactccttggtt
gccagcagggcgtttcctccacgttttgacaacacccggctgagtgacgtcgaccggccc
atcaaccagttgagagtgggaatcgacgacatgaaacgttggcgcgaacgcatctatgag
gccatccatcagggctacgttttggatgcgaaccataaaaagatcgtcctagatgacgtg
aaggggatcgacatcctgggcaatatcatagagagctcccagttgacgcccaacaaaacg
ctgtacggcgacctacacaacaaggggcacatattgattgcgttctcccacgatccgacc
aacaagcacctggagtacgcgggcgtcatgggcgacgcctccaccgcgatgcgcgatccg
atcttctacaagtggcacgccttcatcgacaacttgttccaggagcacaagcgtcagctt
tcaccctatacggaggaggacctgacctttccggatgttcgcgtccagagcattcaagtg
gagagccagggtcaggtcaacaggctgaccaccttctggcaggagtccgatgtggacatg
tcccgcggccttgattttgtgccacgcggccatgtcctcgctcggttcacccatctgcag
caccacccattcagctacaccatcgaggtggagaactccagcgaggccacgcggtatgga
tacgtgcgcatcttcctggcgcccaagctggatgatggcaatgcaaccatgctgctggag
cagcagcgccggatgatggtggaactggacaagttcgtagttaccatgcctcccggaagc
catactattacccgggactccacggagtcaagtgtcaccattccgttcaagcgcaccttc
cggaacatggacaatccgggtgaaccacagaacttcttatgcggctgtggctggccccag
cacatgttgattccgaagggtcgggccgagggtctgagtttcgagctcttcgtcatggtt
tccaactacgaagacgataaggtcgaccagaagccagaggattgtgagtgcagcattgcc
gcttcctactgcggactgcgcgatcgcctctatccggatcgcaagtccatgggcttcccc
ttcgatcgccagccccgcagtggctctgagctcctggagaagttccttacgcccaacatg
tgctccatcgaggtcattatttcccatgaggcccgcaccgaaaagattcccgaattgccg
gaccactcttga

DBGET integrated database retrieval system