KEGG   Drosophila erecta: Dere_GG22822Help
Entry
Dere_GG22822      CDS       T01060                                 

Gene name
Dere_Dox-A3
Definition
GG22822 gene product from transcript GG22822-RA
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
der  Drosophila erecta
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dere_GG22822 (Dere_Dox-A3)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dere_GG22822 (Dere_Dox-A3)
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dere_GG22822 (Dere_Dox-A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 683 aa AA seqDB search
MADKKNLLLLFDHPTEPVFMDKGGNGTVFDVPASYVTDRYNKMCKKVQRRVSGGFEKNVL
VKEIPIPDLSCSMRLGRSEQFSLFLESHRQMACHLIDVFIKMPTVDELQSVAVYARDRVN
PVLFNYALSVAMLHRSDTKDLGLPAFAQIFPDRFIDSQMLRTMREESFVVERSAARLPVH
SSVKYTASDLDVEHRLWYFREDLGVNLHHWHWHLVYPNTAPDRSIVDKDRRGELFYYMHQ
QIIARYNAERLCNHMARVQPFNNLEEPIAEGYFPKMDSLVASRAFPPRFDNTRLSDVDRP
INQLRVGIDDMKRWRERIYEAIHQGYVLDANHKKIVLDDVKGIDILGNIIESSQLTPNKT
LYGDLHNKGHILIAFSHDPTNKHLEYAGVMGDASTAMRDPIFYKWHAFIDNLFQEHKRQL
SPYTEEDLTFPDVRVQSIQVESQGQVNRLTTFWQESDVDMSRGLDFVPRGHVLARFTHLQ
HHPFSYTIEVENSSEATRYGYVRIFLAPKLDDGNATMLLEQQRRMMVELDKFVVTMPPGS
HTITRDSTESSVTIPFKRTFRNMDNPGEPQNFLCGCGWPQHMLIPKGRAEGLSFELFVMV
SNYEDDKVDQKPEDCECSIAASYCGLRDRLYPDRKSMGFPFDRQPRSGSELLEKFLTPNM
CSIEVIISHEARTEKIPELPDHS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagaagaatctcctcctgctgttcgaccatcccacggagcccgtgttcatg
gacaagggaggcaatggcaccgtgttcgatgtgcccgcctcctacgtgaccgatcgctac
aacaagatgtgcaagaaggtccagcgacgcgtcagcggcgggttcgagaagaatgtcctg
gttaaggagatccccatcccggatctcagctgctccatgagactgggccgttcggagcag
ttctcgctcttcctggagtcccaccgccagatggcctgccacctgatcgatgtcttcatc
aaaatgcccaccgtggatgagctgcagagcgtggcggtgtacgccagagatcgtgtcaac
ccggtgctcttcaactatgccttgtcggtggccatgctccatcgatcggacaccaaggac
ctgggtctgcccgccttcgcgcagatcttcccggatcggttcatcgactcgcagatgctg
cgcactatgcgcgaggagtcctttgtggtagagcggtccgctgcccgcctgcccgtccat
agttcggtcaagtacaccgcctccgatcttgacgtggagcaccggctgtggtacttccgc
gaggacctgggcgtcaacctgcaccactggcactggcatctggtctatcccaacacggct
cccgaccgcagcatcgtggacaaggatcgtcgtggcgagctgttctactacatgcaccag
cagatcattgcccgctacaatgccgagaggctgtgcaaccacatggcccgtgtgcagccg
ttcaacaacctggaggagcccattgccgagggctacttccccaagatggactccttggtt
gccagcagggcgtttcctccacgttttgacaacacccggctgagtgacgtcgaccggccc
atcaaccagttgagagtgggaatcgacgacatgaaacgttggcgcgaacgcatctatgag
gccatccatcagggctacgttttggatgcgaaccataaaaagatcgtcctagatgacgtg
aaggggatcgacatcctgggcaatatcatagagagctcccagttgacgcccaacaaaacg
ctgtacggcgacctacacaacaaggggcacatattgattgcgttctcccacgatccgacc
aacaagcacctggagtacgcgggcgtcatgggcgacgcctccaccgcgatgcgcgatccg
atcttctacaagtggcacgccttcatcgacaacttgttccaggagcacaagcgtcagctt
tcaccctatacggaggaggacctgacctttccggatgttcgcgtccagagcattcaagtg
gagagccagggtcaggtcaacaggctgaccaccttctggcaggagtccgatgtggacatg
tcccgcggccttgattttgtgccacgcggccatgtcctcgctcggttcacccatctgcag
caccacccattcagctacaccatcgaggtggagaactccagcgaggccacgcggtatgga
tacgtgcgcatcttcctggcgcccaagctggatgatggcaatgcaaccatgctgctggag
cagcagcgccggatgatggtggaactggacaagttcgtagttaccatgcctcccggaagc
catactattacccgggactccacggagtcaagtgtcaccattccgttcaagcgcaccttc
cggaacatggacaatccgggtgaaccacagaacttcttatgcggctgtggctggccccag
cacatgttgattccgaagggtcgggccgagggtctgagtttcgagctcttcgtcatggtt
tccaactacgaagacgataaggtcgaccagaagccagaggattgtgagtgcagcattgcc
gcttcctactgcggactgcgcgatcgcctctatccggatcgcaagtccatgggcttcccc
ttcgatcgccagccccgcagtggctctgagctcctggagaagttccttacgcccaacatg
tgctccatcgaggtcattatttcccatgaggcccgcaccgaaaagattcccgaattgccg
gaccactcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system