KEGG   Drosophila erecta: Dere_GG22822Help
Entry
Dere_GG22822      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
der  Drosophila erecta
Pathway
der00350  Tyrosine metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dere_GG22822
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dere_GG22822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hemocyanin_C Hemocyanin_M Hemocyanin_N Tyrosinase
Motif
Other DBs
NCBI-GeneID: 6547312
NCBI-ProteinID: XP_001976339
FlyBase: FBgn0064624
UniProt: Q8I1F6
Position
Unknown
AA seq 683 aa AA seqDB search
MADKKNLLLLFDHPTEPVFMDKGGNGTVFDVPASYVTDRYNKMCKKVQRRVSGGFEKNVL
VKEIPIPDLSCSMRLGRSEQFSLFLESHRQMACHLIDVFIKMPTVDELQSVAVYARDRVN
PVLFNYALSVAMLHRSDTKDLGLPAFAQIFPDRFIDSQMLRTMREESFVVERSAARLPVH
SSVKYTASDLDVEHRLWYFREDLGVNLHHWHWHLVYPNTAPDRSIVDKDRRGELFYYMHQ
QIIARYNAERLCNHMARVQPFNNLEEPIAEGYFPKMDSLVASRAFPPRFDNTRLSDVDRP
INQLRVGIDDMKRWRERIYEAIHQGYVLDANHKKIVLDDVKGIDILGNIIESSQLTPNKT
LYGDLHNKGHILIAFSHDPTNKHLEYAGVMGDASTAMRDPIFYKWHAFIDNLFQEHKRQL
SPYTEEDLTFPDVRVQSIQVESQGQVNRLTTFWQESDVDMSRGLDFVPRGHVLARFTHLQ
HHPFSYTIEVENSSEATRYGYVRIFLAPKLDDGNATMLLEQQRRMMVELDKFVVTMPPGS
HTITRDSTESSVTIPFKRTFRNMDNPGEPQNFLCGCGWPQHMLIPKGRAEGLSFELFVMV
SNYEDDKVDQKPEDCECSIAASYCGLRDRLYPDRKSMGFPFDRQPRSGSELLEKFLTPNM
CSIEVIISHEARTEKIPELPDHS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagaagaatctcctcctgctgttcgaccatcccacggagcccgtgttcatg
gacaagggaggcaatggcaccgtgttcgatgtgcccgcctcctacgtgaccgatcgctac
aacaagatgtgcaagaaggtccagcgacgcgtcagcggcgggttcgagaagaatgtcctg
gttaaggagatccccatcccggatctcagctgctccatgagactgggccgttcggagcag
ttctcgctcttcctggagtcccaccgccagatggcctgccacctgatcgatgtcttcatc
aaaatgcccaccgtggatgagctgcagagcgtggcggtgtacgccagagatcgtgtcaac
ccggtgctcttcaactatgccttgtcggtggccatgctccatcgatcggacaccaaggac
ctgggtctgcccgccttcgcgcagatcttcccggatcggttcatcgactcgcagatgctg
cgcactatgcgcgaggagtcctttgtggtagagcggtccgctgcccgcctgcccgtccat
agttcggtcaagtacaccgcctccgatcttgacgtggagcaccggctgtggtacttccgc
gaggacctgggcgtcaacctgcaccactggcactggcatctggtctatcccaacacggct
cccgaccgcagcatcgtggacaaggatcgtcgtggcgagctgttctactacatgcaccag
cagatcattgcccgctacaatgccgagaggctgtgcaaccacatggcccgtgtgcagccg
ttcaacaacctggaggagcccattgccgagggctacttccccaagatggactccttggtt
gccagcagggcgtttcctccacgttttgacaacacccggctgagtgacgtcgaccggccc
atcaaccagttgagagtgggaatcgacgacatgaaacgttggcgcgaacgcatctatgag
gccatccatcagggctacgttttggatgcgaaccataaaaagatcgtcctagatgacgtg
aaggggatcgacatcctgggcaatatcatagagagctcccagttgacgcccaacaaaacg
ctgtacggcgacctacacaacaaggggcacatattgattgcgttctcccacgatccgacc
aacaagcacctggagtacgcgggcgtcatgggcgacgcctccaccgcgatgcgcgatccg
atcttctacaagtggcacgccttcatcgacaacttgttccaggagcacaagcgtcagctt
tcaccctatacggaggaggacctgacctttccggatgttcgcgtccagagcattcaagtg
gagagccagggtcaggtcaacaggctgaccaccttctggcaggagtccgatgtggacatg
tcccgcggccttgattttgtgccacgcggccatgtcctcgctcggttcacccatctgcag
caccacccattcagctacaccatcgaggtggagaactccagcgaggccacgcggtatgga
tacgtgcgcatcttcctggcgcccaagctggatgatggcaatgcaaccatgctgctggag
cagcagcgccggatgatggtggaactggacaagttcgtagttaccatgcctcccggaagc
catactattacccgggactccacggagtcaagtgtcaccattccgttcaagcgcaccttc
cggaacatggacaatccgggtgaaccacagaacttcttatgcggctgtggctggccccag
cacatgttgattccgaagggtcgggccgagggtctgagtttcgagctcttcgtcatggtt
tccaactacgaagacgataaggtcgaccagaagccagaggattgtgagtgcagcattgcc
gcttcctactgcggactgcgcgatcgcctctatccggatcgcaagtccatgggcttcccc
ttcgatcgccagccccgcagtggctctgagctcctggagaagttccttacgcccaacatg
tgctccatcgaggtcattatttcccatgaggcccgcaccgaaaagattcccgaattgccg
gaccactcttga

DBGET integrated database retrieval system