KEGG   Drosophila erecta: Dere_GG23717Help
Entry
Dere_GG23717      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
der  Drosophila erecta
Pathway
der00062  Fatty acid elongation
der01100  Metabolic pathways
der01212  Fatty acid metabolism
der04142  Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Dere_GG23717
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG23717
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dere_GG23717
Lipid biosynthesis proteins [BR:der01004]
 Fatty acid synthase
  Component type
   Dere_GG23717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 Abhydrolase_1 PGAP1 Abhydrolase_6 FSH1 DUF2974 Hydrolase_4 Peptidase_S9 Abhydrolase_2 PE-PPE Cutinase
Motif
Other DBs
NCBI-GeneID: 6541752
NCBI-ProteinID: XP_001969844
FlyBase: FBgn0115858
UniProt: B3N4J1
Position
Unknown
AA seq 288 aa AA seqDB search
MRLHLQVLVALITATSIGSSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDK
FSGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFI
SLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLQYSEF
LPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFSYFDENMDVIPFIKR
TIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIMPYLD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcatttgcaagtcctggtggccctgataaccgccacgtccattggcagctca
ctggcctacaaaccggtggtcattctgcacggaattctctccggagccgaatcgatggct
tccctggtccgggaaatcgaagagtttcatcctggcaccatcgtctacaactgcgacaaa
ttcagtggatggtacagcttggagaacgcctggcgacaggtcgatcaggtcagggattac
ctcaacgaggtgggcaaactgcatccagagggcatcatagttctgggatactcccaagga
ggccttttggcccgtgcggccatccaaagtctgccggagcacaatgtaaagaccttcata
tctctatcctcaccacaggcgggacaatacggcaccagcttcctccatctgatatttccc
gatttggcggccaagacggccttcgagttgttctactcgcgcgtgggacaacacacctcg
gttgggggctactggaacgatccgcagaggcaggacttgtacctgcagtacagcgagttc
ctgccactgatcaataatgagaagaagacctccaactccacgtccttcaagatgggaatg
gtgcggctgaacaagttggtgatgatcggcggacccaacgacgatgtgattactccgtgg
caatcgagccactttagttacttcgatgagaacatggatgtgattccttttattaagcga
acgattttcaccagcgactccattggcatcaggacgctccaggaggctggcaagctgatc
attgtggtcaaaccccatgtccaccaccttgcctggcacacgcgcagggatgtcatccac
gaagtgataatgccatatctggactga

DBGET integrated database retrieval system