KEGG   Drosophila erecta: Dere_GG23806Help
Entry
Dere_GG23806      CDS       T01060                                 

Definition
GG23806 gene product from transcript GG23806-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
der  Drosophila erecta
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dere_GG23806
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dere_GG23806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2470 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHAAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANASFSADLATS
KDQKGMTRDDRIHGGLIVFNELFRCANATWERRYTSLKTLFPKTHHNKFLEASSSSGMGS
QLNTLVPRLKVPFIEKLGSTQTHLGEGEHHKGVAKFASHNVLESAYAQEILQDHYTTICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAYI
TIGYMAVAVQSAIEIHLSSIMTSVKVALPAKDLTSKRKVPVDPAVFACITLLAHAVKSEI
AGDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKATVVPYT
ALPSIAIDGSLMQNADGATTVLALKTLGTFNFEEQNMLDFVQRCADFFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFD
AKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELITDLKYS
GMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA
EVNGGSDEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE
SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKC
VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINT
PLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGST
LGYYLPLILPPIVKLFDSPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDAE
PELRGQAMITLRSLVKQLGKKYLVFVPMVQRTLNKHRIADPEYEKLLSLIQTNSTTADSC
GAGESGLRTAKSKNNEPFVTDRNSNNKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRLSI
GLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQVTD
MPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLQEDSQVF
ESLILINNKLQQREAAEGLLTTYKNAAKELNVQGRWYEKLHNWDQALEHYKGNLKKDSLD
LEARLGHMRCLEALGDWSELSTVTKNEWETFGTEAKSRAGPLAAVAAWGLQDWEAMREYV
RCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCV
QMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDDIHTW
LKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQLQDA
YDQLRHFVETYSQELSCLPPEALKQQDQRLMARCCLRLATWQNKLQDSTGPEAIPGALEF
FEKATSYDPNWYKAWHLLAYMNFKVVQAQKSALDKQQPPGASMGMTMNLGLDSDLMIIQR
FAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQVI
PQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDSMR
KHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAMLE
RGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQLT
SLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGSNG
KDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGW
VPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDL
AKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFG
DCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLE
AFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPT
MQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTQKSVNEQQQVDLLILQATNNENLC
QCYIGWCPFW
NT seq 7413 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccggaat
gtacagaacaaggccacccaggatctgctcttctatgtgaagaccgagctgcgtgagatg
tcccaggaggagctggcgcaattcttcgacgagttcgaccaccacatcttcacgatggtg
aatgcgacggacatcaacgagaagaagggtggtgccctggccatgaagtgcctgattaac
tgcgagggcagtctaactgccagaaagggaatttctccatatctcaaccgcctgcgcgat
cttctactgatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaaattg
gccaacatgcccacctccaagggagccgactcctttgacttcgatattaagaaggctttt
gaggtgctcaggggggagagacaagagtaccgccgacatgcagccgtgtttatcctccgt
gagctggcgatcgccttgccgacatacttctaccagcacatcctgaccttctttgaggtt
atcttcaacgccatcttcgatcccaaacctgctatacgagagtctgctggcgaggctttg
agggcggctttaattgtcacagcgcagcgagagagcaccaaacagtctagtgaaccacag
tggtacagaatctgctatgacgaggccaatgcgagcttcagtgcagacttggccactagc
aaggatcagaagggcatgacccgagacgatcgcattcacggcggcctcatcgtcttcaac
gagctcttccgctgtgccaatgccacatgggagcggcgatacacgtcgcttaagacgctg
ttccccaagacccaccacaacaagttcctggaggccagcagttcgtcgggtatgggctcc
cagctgaacactttagtgccgcggctaaaggtgcccttcattgagaagctcggcagcacc
caaacgcatttgggcgagggagagcatcacaaaggagtggccaagttcgcgagccataac
gtactggagtctgcctatgcccaagagatcctccaggaccactacactaccatttgcgac
aatgttttggagcagcgaacttcgaagtctccgtatgtacagcaggcactccttcaaata
ctgccccgcttggctgcttttaaccgcgcggtctttgtggaaaaatacctacagacatgc
gtgtcgcatttgatgcagatcctgcggggcaaggagaaggatcgcacggtggcctacatt
accattggttacatggctgtggcagtgcagagtgcgattgaaattcatctatccagtata
atgaccagcgtgaaggtcgctttgccagcaaaggatttgaccagcaaacgaaaggtacca
gtggatcctgcggtctttgcctgcattacgctccttgcgcatgccgttaagtcggagata
gccggcgatgttaaggatatccttgagcagatgttctacacgggtctctcgccagctctt
actgtttgcctaagggaactctccgagaatgtgccgcagctaaagtcggccattacagaa
gggttgatcggaatcctatcccaggtgctgatgaacaaggcgactgtagtaccatacact
gctttgccatcgatcgccatcgatggttcgctgatgcagaatgctgatggagccaccaca
gtgctggcactaaaaacactgggtaccttcaactttgaggagcaaaacatgctggacttc
gtgcaacggtgtgccgacttcttcattgtacacgagcagcaggagattcgcctggaagca
gtgcaaacctgcacacgactcctcaaactggcagtgcaatcctctgaaagtatggagaac
tccaagacactcagcgacaccgtttcgcacgtgattgagcgcctgctcatggtggcaatt
actgatatggactgcaatgtgcgaatacgaattctgcgttcgctggacgagacctttgat
gcgaagcttgctcagccagagtccctgaattcactatttattacgctacatgacgaaatc
tttgagatccgcgagctggcaatggttaccattggaagattatcgtccatgaacccggcc
tatgtgatgcccaaattaagaacgaccatgatcgagttaatcacggatctgaagtactcg
ggaatgagtcggaacaaggagcagagcgccaagatgcttgaccatttggtgataagcacg
cccaggctaatatcctcatatatgaatccgatccttaaggccttagtgcccaagttgcat
gagccggaatcgaatccaggagttattttaaatgtgctgcgcaccattggtgatcttgca
gaggtaaatggaggctccgatgaaatggaactgtgggcagacgaccttttgtccatttta
ctcgaaatgctgggcgacgctggcagtccggataagcgaggagtggccctgtggaccttg
ggacagttaatcagtgcaacgggcagggtggttagcccatatcacaagtaccccgtgctc
atagacattctgattaatttccttaaaacggaacaacgtcgttccatacgaagggaaacg
atccgagtgctgggcttattgggagccatggatccctacaagcataagatgaacaagggc
ttgattgatagccaaaaggataatgttttaatagcatactccgatggcaaggtagatgaa
agtcaggacatctccaccgcagagctgctggttaatatgggtaacgcattggatgagtac
tatcccgctgtggccatagctgccttgatgaggatcctacgggatcccacgctgagtacg
cgacacaccagtgtggtgcaggcggtgacgtttatcttccagagtctgggcatcaaatgt
gtgccatatttggcccaagtgcttccaaatttgctggacaacgtacgcactgcggataac
aatcttagggagttcctcttccagcagctggccattctggtggcttttgtgaagcttcac
atcatcagctacatgggagatattttcaagctgatcaaagagttttggaccattaacaca
cctctgcaaaacactttaatcaatttgattgaacagatcgccgtggccttgggatgcgag
tttagggattatttggcggagctgatcccacaaattctgcgagtgttgcagcacgacaac
tccaaggacagaatggtcaccagaaggctgctccaagctcttcaaaagtttggcagcacc
ttggggtactatctgccgctgattttgcctccaatcgtgaaactcttcgattcgccgtat
gtacctcagcaggtttcaatggtagccctggaaacgatcaacaatctagcctgtcagctc
gacttcaccgacttctcctcgcgcatcatacatccgctggttcgagtgctcgatgctgaa
ccagagcttcggggccaggccatgataaccctccgctctctggtgaagcaactcggcaag
aagtacctcgtgttcgtgccaatggtccagcgcaccctcaacaagcatcgcattgcggat
cccgaatacgagaagctactgagtctgattcagaccaacagcacaacggcggattcctgt
ggggccggagagtcaggtctgcgcacggccaagtccaaaaacaacgagccattcgtgact
gaccggaatagcaataacaaaaatctgcaggttaccacaaacgaactacgaacggcgtgg
caggtgacgcgccgggtgtccaaagacgactgggtggagtggctaaagcggttgtccatt
ggcctgttaaaggaatcgccctcgcacgcacttagagcctgtcgttcgttggcccaagag
tacgatacgctgttgcgagatctttttaacgccgcatttatctcctgttggacggaactt
tcgccggatctgaaaaacgagctaactcagtcgctgattcaagccctgcaagtcaccgac
atgccggagatcactcagacaattctcaaccttgctgagttcatggagcattgcgaccgc
gatccaataccaatagaaacaaagctattgggtacccgagcgatggcttgcagagcctat
gccaaagcattgcgttacaaggaggaggagtttctcctccaggaggattcccaagttttc
gagtccctgattctaatcaacaacaagctgcagcaaagagaagcagcggaaggtctgctt
acaacctataagaatgcagccaaggagctaaatgttcaaggaagatggtatgaaaaactt
cacaattgggatcaggcgctggaacattataaagggaatctaaagaaggattccttggac
ttggaggcccgcctcggtcacatgcgctgcttggaggccctcggagattggtcggagctg
agtaccgtgaccaagaacgagtgggaaaccttcggaacggaggccaaatctagagcagga
cctttggcagcggtagctgcctggggtctccaggattgggaagcgatgcgggagtacgtg
aggtgtataccagaggacacccaagatggaagctactatcgagctgtgctcgcggtgcat
catgacgactttgagaccgcacagcgccttattgacgaaacgagggacctcctagacacg
gagcttacatcaatggcgggcgagtcctatgaaagagcctacggagccatggtatgcgta
caaatgctggcggagctggaggaggtcatccaatacaagctgatcccagagaggcgagag
cccttaaagaccatgtggtggaagcgtcttcaaggagggcagcgactggtagaggactgg
cgcaggatcatccaggtgcactcgctggtggtcaaaccgcacgacgacatacacacctgg
ctgaagtacgccagtttgtgcagaaaaagcggttctctgcacctgtcccataaaactctg
gtgatgctacttggcaccgatcccaagcttaatccgaaccagccactgccgtgcaatcag
ccccaggtgacttatgcgtacaccaagtacatggctgccaataatcagctgcaagatgcc
tacgatcagttgaggcacttcgtagaaacctacagtcaggagctgagctgcttacctccg
gaagcactaaagcagcaggatcagcgacttatggcccgctgctgtctgcgcttggccacc
tggcagaacaagctgcaggacagcaccggaccggaggccattccaggcgccctcgagttc
ttcgaaaaggccactagctacgatcccaactggtacaaggcctggcacctgttggcatac
atgaactttaaggtggtgcaggcccaaaaatcggcgctggacaaacaacagcctcccgga
gccagtatgggtatgacaatgaacttgggcctcgacagtgatctaatgatcatacagcga
ttcgccgttccggccgttcagggattcttccgttcaatcagccttataaagggcaattca
ctgcaggacacgctacgtctcttaaccctttggtttgactatggcaaccatgcggaggtg
tacgaggcactgctctctggaatgaagctgatcgagatcaacacctggcttcaggttatc
ccgcagcttattgcccgcatcgatacccaccgtcagttggtgggtcaactgatccaccag
ctgcttatggacataggaaagaatcacccgcaggctctggtctatcctctaacagtcgct
tccaagtcggcgtcattggcgcgcaggaatgccgcatttaagatcctcgactcgatgaga
aaacactcgcccacattggttgagcaggcggtcatgtgcagcgaggagctcatccgtgtg
gcgattctgtggcacgaacagtggcacgagggcttggaggaggcgtcgcgactctacttt
ggagatcgcaacgtaaagggcatgtttgagattttggaaccactgcacgctatgctggag
aggggaccgcagacgctcaaggagacatccttctcgcaggcgtacggacgcgagctgacg
gaagcctacgagtggtcgcagcgatacaagacatcggcggtggtgatggatttagatcga
gcctgggacatctactaccacgtcttccaaaagatctcgcgccagctgccacagcttact
tcgctggaactgccgtatgtatcgccaaaactgatgacctgcaaagatctcgagctggcc
gtacccgggtcctacaatcctggccaggagctcatccggattagtatcattaaaacaaac
ctgcaggtgataacatccaagcagcgcccacgaaaactgtgcattcgtggctccaatggc
aaggactatatgtaccttctaaagggacacgaggatcttcgtcaggacgaacgcgtgatg
cagctattttccttggtgaatacattgctattggatgaccccgacacgttccgacgtaac
ctggctatccagcggtatgcggttatcccgctcagtaccaactcgggccttatcggttgg
gtgccacattgtgacaccctgcatacgcttatccgcgactaccgcgacaagaagaaggtg
ccactaaatcaggagcatcgcacaatgctcaactttgcgccagactatgatcacctcacg
ctgatgcagaaggttgaagtgttcgagcatgcgttgggtcagacgcaaggcgacgacttg
gccaagttgctgtggctcaagtctccgtcctccgaattatggtttgagcggagaaacaac
tacacccgctcactggcagtcatgtcaatggtgggatacatcctgggtctgggcgatcgg
catccatcgaatcttatgctggatcgaatgagcggcaagatactgcacatagacttcggc
gactgctttgaggtggccatgacgcgcgaaaagtttcccgagaagatacccttccgtctc
acccggatgctaatcaaggcgatggaggtcactggcatcgagggcacctaccggcgcact
tgcgaaagcgtgatgctggtgctccgccgcaacaaggactccctgatggcggttctggag
gcctttgtctatgatccgctgctcaactggagactgttggatgtggacaagaagggtaac
gatgcggtggctggtgcgggggctccaggtggaaggggcggttccggaatgcaggacagc
ctcagcaactccgtggaggactccctgcccatggccaagtcgaagccctacgatcccacg
atgcagcaaggcggcctgcacaacaacgtggccgacgagacgaacagcaaagccagccag
gtaatcaagcgggtcaagtgcaagctaacaggcaccgacttccagacgcaaaagagcgta
aacgagcagcagcaggtggatctgctcatcctgcaggctaccaacaacgagaacctctgc
cagtgctacattggttggtgtccgttttggtag

DBGET integrated database retrieval system