KEGG   Drosophila erecta: Dere_GG23876Help
Entry
Dere_GG23876      CDS       T01060                                 

Definition
GG23876 gene product from transcript GG23876-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dere_GG23876
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dere_GG23876
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Dere_GG23876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 361 aa AA seqDB search
MAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSSVH
AKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQK
LSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGT
PADEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDSDKRITAEQ
ALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFSEVTAFKPSAAFAELLSKE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggccaagttctacaagctggacatcaaccgcaccgagtgggagatcccggagacatac
cagaacctgcaaccagtgggtcagggtgcatacggtcaggtctgcaaggctgtggtccgc
ggaaccagcacgaaggtggccatcaagaagctggccaggcccttccagtcgtcggtccat
gcgaagcgcacctaccgggaactgcgactgctgaagcacatggaccacgagaacgtaatt
ggtctgctggatgtctttcatccgggacagcccgccgattctctagatcagttccagcag
gtgtacatggtgacccacttgatggacgccgatctgaacaacataatacgcacgcaaaag
ctgtccgatgatcatgtccagtttctggtgtaccaaatcctgcgcggtctgaagtatatc
cacagcgctggggtcatccatcgcgatctaaagccatcgaatattgcggtgaacgaggac
tgtgagcttcgcatcctagacttcggattggctcgtcccgccgaaagcgagatgaccggg
tacgtggctacgcgatggtaccgggcgcctgagatcatgctcaactggatgcactacaac
cagacggtggacatctggtcggtgggatgcattatggccgagctgctgactggacggacg
ctgttccctggaaccgatcacatccatcagctgaacctcatcatggaagtgctgggcacg
ccagctgatgagttcatgagccgcatttcctcggagagcgctcggaactatatccgttca
ctgccggtgatgccgcgccgcaatttccgcgacatcttccgcggtgccaacccgctggcc
attgatttgctggagaagatgctggaactagattcggacaagcgcattactgccgaacag
gcgctggcccatccctacatggagaagtaccacgatccaaccgatgagcagaccgccgca
ctctacgatcaaagcttcgaggagaacgagctgccggtggagaagtggcgggagatggtc
ttcagcgaggtgacggccttcaagccctcagccgccttcgccgagcttctgtccaaggag
cagtaa

DBGET integrated database retrieval system