KEGG   Drosophila erecta: Dere_GG23876Help
Entry
Dere_GG23876      CDS       T01060                                 

Definition
(RefSeq) GG23876 gene product from transcript GG23876-RA (EC:2.7.11.24)
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
der  Drosophila erecta
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dere_GG23876
   04068 FoxO signaling pathway
    Dere_GG23876
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dere_GG23876
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dere_GG23876
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dere_GG23876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 365 aa AA seqDB search
MSRKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQ
SSVHAKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII
RTQKLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAES
EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIME
VLGTPADEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDSDKRI
TAEQALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFSEVTAFKPSAAFAEL
LSKEQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcaaaatggccaagttctacaagctggacatcaaccgcaccgagtgggagatc
ccggagacataccagaacctgcaaccagtgggtcagggtgcatacggtcaggtctgcaag
gctgtggtccgcggaaccagcacgaaggtggccatcaagaagctggccaggcccttccag
tcgtcggtccatgcgaagcgcacctaccgggaactgcgactgctgaagcacatggaccac
gagaacgtaattggtctgctggatgtctttcatccgggacagcccgccgattctctagat
cagttccagcaggtgtacatggtgacccacttgatggacgccgatctgaacaacataata
cgcacgcaaaagctgtccgatgatcatgtccagtttctggtgtaccaaatcctgcgcggt
ctgaagtatatccacagcgctggggtcatccatcgcgatctaaagccatcgaatattgcg
gtgaacgaggactgtgagcttcgcatcctagacttcggattggctcgtcccgccgaaagc
gagatgaccgggtacgtggctacgcgatggtaccgggcgcctgagatcatgctcaactgg
atgcactacaaccagacggtggacatctggtcggtgggatgcattatggccgagctgctg
actggacggacgctgttccctggaaccgatcacatccatcagctgaacctcatcatggaa
gtgctgggcacgccagctgatgagttcatgagccgcatttcctcggagagcgctcggaac
tatatccgttcactgccggtgatgccgcgccgcaatttccgcgacatcttccgcggtgcc
aacccgctggccattgatttgctggagaagatgctggaactagattcggacaagcgcatt
actgccgaacaggcgctggcccatccctacatggagaagtaccacgatccaaccgatgag
cagaccgccgcactctacgatcaaagcttcgaggagaacgagctgccggtggagaagtgg
cgggagatggtcttcagcgaggtgacggccttcaagccctcagccgccttcgccgagctt
ctgtccaaggagcagtaa

DBGET integrated database retrieval system