KEGG   Drosophila erecta: Dere_GG23884Help
Entry
Dere_GG23884      CDS       T01060                                 

Definition
GG23884 gene product from transcript GG23884-RA
Orthology
K03099  
son of sevenless
Organism
der  Drosophila erecta
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dere_GG23884
   04630 Jak-STAT signaling pathway
    Dere_GG23884
   04068 FoxO signaling pathway
    Dere_GG23884
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dere_GG23884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1582 aa AA seqDB search
MFSGPSGHAHTISYGGGIGLGTGGGGGGGSQGGGGGGVGIGGGGVAGLQDCDGYDFTKCE
NAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEK
VNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLVAVL
EYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQR
ASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVTDPRELEPIFSNIMDIYEVTVT
LLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLLSKPG
ASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQVQGLL
HPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNEFIRE
DSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRRVDIN
DRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSILQDIE
RKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYADPTFV
RTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGAAGAGGIGGVGGDKEHKNSHRED
WKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLSFLEHVNGKSMRKWVDSV
LKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFEM
YKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQRA
IEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHLKKY
QERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQ
PYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPLK
SPGIKPRRQNQTNSSSKLSNSMSSVAAAAAASSTATTIATAAAPSLHASSILDAPAAGSN
AGSGTLAGEQSPQHNPHAFSVFASVIIPERNTSSWSGTPQHTRTDQSNGEVSVPAPHLPK
KPGAHVWANNSTLASASAMDVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLPKLVVSPR
HETGNRSPFHGRMQNSPTHSIASTVTLTGMSASAGEEFCPGGFYFNSAHQGQPGAVPISP
HVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPR
LNHSTGISYLRQSHGKSKEFVGKSSLLLPNTSSIMIRRNSAIEKRAAATTQPSAVGPIST
TLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVESTTSSYAHQLR
MRQQQTHPAIYSQHHHATHLPHHQHQHHSNPTQSRSSPKEFFPIATSLEGTPKLPPKPSL
SANFYNNPDKGTMFLYPSTNEE
NT seq 4749 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccattagctacgggggcgggatcggtctg
ggcaccggaggcggtggtggtggtggctcacagggcggcggaggcggtggtgttggcatt
ggcggcggtggcgtggctggactgcaggactgcgatggctatgacttcaccaaatgcgag
aacgctgcgagatggaggggcttgtttacgccgtcgctgaagaaggtgctggagcaagtg
catccacgggtcaccgccaaggaggacgctctgctgtatgtggagaaactctgcctacgg
ctgttggctatgctgtgcgccaaaccgctgccccactccgttcaggatgtggaggaaaag
gtgaacaagtcctttccggcgcccatcgatcagtgggctctcaacgaggccaaggaggtg
atcaattcaaagaagcgcaagtctgtcctgcccacggaaaaggtgcacacgctgctccag
aaggatgtgctgcagtacaagatcgacagctccgtgtccgccttcctggtggccgtgctg
gagtacatctctgcggacatactcaaaatggccggcgactatgtgatcaagatcgcccac
tgcgagatcacgaaggaggacatcgaggtggtgatgaacgccgatcgcgtgctaatggac
atgctcaaccagagcgaagcccacatcctgcccagtcccctgtcactgcccgctcagcgg
gcaagtgccacctacgaggagacggtcaaggagctgatccacgacgagaagcagtaccag
cgcgacctgcacatgatcatacgcgtctttcgcgaggagctggtgaagatcgtgaccgat
ccccgggagctggaaccgatattctccaacataatggacatttacgaagtgacggtgact
ctgctcggctccctggaggacgtcatcgagatgtcccaggagcagagtgccccttgcgtg
ggcagctgctttgaggaactggccgaggccgaggagttcgacgtgtacaagaagtacgcc
tacgatgtgacttcgcaggcatcacgggatgccctcaacaatctcctgtccaagccaggg
gcctcatctctgactacagccggccatggctttcgcgatgctgtcaagtactatttgccc
aagctgcttctggtgcccatttgccatgccttcgtgtacttcgactacatcaagcacctc
aaggatctcagctcgtcgcaggacgacatcgagagcttcgagcaggtccagggcctgctg
catccactccactgcgatctcgagaaggttatggcaagtctgtccaaggagcggcaagta
cccgtcagcggacgagtgcgtcgccagctggccatcgagcggacacgggagctgcaaatg
aaggtggagcactgggaggataaggacgtgggccaaaattgcaatgaatttattcgcgag
gattcgctaagcaagcttggatcaggaaaacgaatctggagcgagcgcaaggtgtttctc
ttcgatgggctgatggtgctatgcaaggcaaacaccaaaaagcaaacgccatcggcagga
gcaacggcctacgattaccggctgaaggagaagtattttatgcgacgcgtagatatcaac
gaccgaccggacagcgatgacctgaagaacagctttgagttggcacccaggatgcagccg
ccaattgtgctgaccgccaagaatgcgcagcacaagcacgattggatggcggacctgctg
atggtgatcaccaagtcgatgctggaccgccacttggacagcattctgcaagacatcgag
cggaagcacccactgcgaatgcccagcccggagatttacaagtttgcggtgccggacagc
ggtgacaatatcgtgttggaggagcgcgaaagcgctggagtgccgatgatcaagggcgcg
acgctttgcaagctcatcgagcggctcacctatcacatctacgccgaccctaccttcgtg
cgcaccttcctcaccacatatcgctacttctgctcgccgcagcaattgctgcagctgctt
gtggagcgctttaacataccggatcccagcttggtctatcaagacactggcgcagcaggt
gcgggtggaatcggcggcgttggcggtgacaaggagcacaagaactcgcatcgtgaggac
tggaagcgctatcgtaaagagtatgtgcagccagtgcagtttcgagtgctcaacgtgctg
cgccattgggtcgaccaccatttttacgatttcgagaaggatcccatgttgctggagaag
ctgctcagctttctggagcacgtgaatggcaaatcgatgcgcaagtgggtggactccgtg
cttaagattgttcagagaaagaacgagcaggagaaaagcaataagaagattgtatacgcc
tatggccacgatccgccgcccattgagcatcaccttagcgtacccaacgacgagataacg
ctcctcaccctgcacccactagaactggcccgtcagctcactctgctggaattcgagatg
tacaagaatgtaaagccctctgagttggtcggatccccctggacgaaaaaggacaaggag
gtgaagagccctaatttactgaagattatgaagcacaccacaaacgtgacgcgctggatt
gagaaatccatcaccgaagctgagaattacgaggaacgacttgcaattatgcaacgcgca
atcgaagtgatgatggtgatgctggaattgaacaattttaatggaatcctctcgattgtc
gcggcaatgggcacggcatcagtttatcgactgcgctggacgttccagggattgcccgaa
cgctacagaaagttcttggaagagtgccgcgagctcagtgacgatcatctcaagaagtat
caggaacgattgcgatccatcaatccgccttgtgtgccatttttcggtcgctacttgacc
aacatactccacttagaggagggaaaccccgacctgctagccaacacagagctaattaac
ttctcaaaacgacggaaagtggccgagattattggcgagattcaacagtaccagaaccag
ccatactgtctcaatgaggagtccacaatacgacaattcttcgagcaactggatccgttt
aacggactgtccgacaaacagatgtctgactatctctataacgaaagtttacgcattgag
ccaaggggctgcaagacggtgccgaaattccctcgaaagtggccgcacattccgctcaaa
tcgccgggcattaagccgcgtcgtcagaatcaaaccaacagcagtagcaagctgtcgaac
agcatgtcgtcagtggcggcggcagcggcagcttcgtcaacggccaccacaatagcgact
gcagcagctccatctttgcatgcctccagtatattggatgcgccagcagcaggctcaaat
gctgggtccggaactctcgctggcgagcaaagtccgcagcacaatccacacgcgttctcc
gttttcgcctctgttattatacccgaacggaatactagcagctggagtggtacgccacag
cacactcgaacggatcagagcaatggggaggtttcggtgccggcgccacatctccccaag
aaacctggcgcgcatgtctgggctaacaattcgacactggccagtgcgtcagcaatggat
gtgttcagtccagcgctgccggagcacctgccaccgcagtccctgccagatagcaatcca
tttgcatcggacacggaagctccgccctcgccgctgcccaagctagtggtcagtccgcgt
cacgaaaccggcaatcgatcaccattccatgggcgtatgcagaacagcccaacgcacagc
atcgctagtaccgtgaccctaacaggcatgtctgcatcggccggggaggagttctgcccg
ggtggcttctatttcaacagtgcccatcagggacagccaggggcagtgcccatctcgccg
catgtcaatgttccgatggccaccaatatggagtaccgagcagtgccgcctccactgcca
cccagacgcaaggagcgcactgagagctgtgcggacatggcgcaaaagcgacaggcgcca
gacgcacccacattacccccgcgtgatggcgaactcagtccgcccccgataccgccacgg
ctcaaccattccacgggcatcagctacttgcgacagagccatggcaagagcaaggagttt
gtgggcaagagcagtctgctcctgcccaacaccagcagtattatgatacgccgcaactcg
gcgatcgagaagcgggcagcggcaactacccagccatcggcggttggacccatcagcacg
acactagtgaccgtgtcgcaggcggtggcgacggacgaaccgctcccgctaccaatctcg
ccagcggcaagctcctcgacgaccacatcaccgctgacacccgccatgtcgcccatgtcc
cccaacattcccagccatccggtggagagcacgacgagcagctatgcccaccaactgcga
atgcggcagcagcagacgcatcccgcgatttactcgcaacaccatcatgccacccatctg
ccgcatcatcaacaccagcaccattcgaatccgacgcagtcacgctcgtccccgaaggag
ttctttccgattgccacgagcctcgagggcacacccaaacttccaccaaaacctagtcta
agcgctaacttctataacaatccagataaaggtacgatgtttctttacccaagtacaaac
gaagaataa

DBGET integrated database retrieval system