KEGG   Drosophila erecta: Dere_GG23906Help
Entry
Dere_GG23906      CDS       T01060                                 

Definition
GG23906 gene product from transcript GG23906-RA
Orthology
K15013  
long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
der  Drosophila erecta
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation, acyl-CoA synthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:der01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:der00071]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 666 aa AA seqDB search
MSAIDALYNRPGPNRLRQAEAYRTTNREDAVKIRMAKDGIGAEEPISVPGLLKRTVNNYG
DYPALRTKNGKNGYHTVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMG
AIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPNLKAAIQIQ
EPYSPYLKKEDGYYRWSEIESMNVSDVEDQYKTRLENVAINECCCLVYTSGTVGMPKGVM
LSHDNITFDVRGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDA
LKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVS
QGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFG
MSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEK
TEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAIS
NAFLVGEQRKYLTVLITLKTEVDKESGEPLDELSHESSVWMKSLGVEHKTISEILAAGPC
PKVWTSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADE
IEKLYA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgatagacgcgctctacaatcgtcctgggcccaaccgcctaaggcaggcggaa
gcctaccgcaccaccaaccgcgaggatgccgtcaagatacggatggccaaggatggaatc
ggcgcagaggaacccatctcagtgcccggcctgctgaagcgtacggtcaacaattacggc
gactatcctgcgctgcgcaccaagaacggcaagaacggatatcacactgtcacctacaaa
caatatgagcagaaggtgcaccaggtggccaaggccttcatcaaactgggcctggaggaa
caccactcggtgggtgtgctggccttcaactgcgccgagtggttctactcggccatgggc
gccatccatgcgcgcggcatcatcgccggaatctacaccaccaattccgccgatgcagtg
cagcacgtcctggagagctcacatgcccagatcgtggtcgtcgatgacgccaagcaaatg
gacaagatccacgccatccgcgacaagctgcccaacctgaaggccgccattcagatccag
gagccctattccccctacttgaagaaggaggacggctactacaggtggtccgagatcgag
tcgatgaacgtgagcgacgtggaggatcagtacaagacccggctggaaaacgtggcgatc
aacgagtgctgctgcctggtatacacctccggaacggtgggcatgcccaagggcgtgatg
ctctcccacgacaacatcaccttcgatgtgcgcgggatcgtcaaggccatggaccgggtg
gtggtgggggcggagtcgatcgtctcctaccttccgctctcgcacgtggccgcccagact
gtggacatttacacctgcgcctttgtggcgggctgcatctggttcgccgacaaggatgcg
ctgaagggaacgctggtgaagtcgctgcaggacgcgcgtcccacgcgtttcatgggcgtg
ccgcgtgtctacgagaagttccaggagcgcatggtggccgtggccagctccagcggcagc
ctgaagaagatgctcgccagctgggccaagggcatcacgctgaagcactacatggtgagt
caaggcaagagctccgggggattccggtacaagattgccaagtcgctcatcatgtccaag
gtgaagcaggccctgggcttcgatcgcgtcctgaccctggccagtgccgcagctcccatg
tcgccggagacgaagaagtacttcctcagtctggacctgaagattgttgatgccttcggc
atgtcggagacggccggctgccacaccatctgccttccagattccgtgggcctgaacaca
atcggcaaaactctgcctggctgcgagtccaagttcatcaacaaggacgccaacggccac
ggagagttgtgcatccgcggacgccacgttttcatgggctacatcgacaacaaggagaag
accgaggagtcgctggacgacgactgctggctgcactccggtgacttgggctttgtggat
gacaagggatatgtttccctgacgggacgatccaaggagattatcatcaccgccggcggc
gagaacattccgcctgtgcacatcgagaacacgatcaagaaggagctggatgccatttcg
aacgccttcttggtgggcgagcagcgcaaatacctcactgttctgatcactcttaagacc
gaagtggacaaggagtccggcgagcccctggacgagctgagccacgagtcctccgtgtgg
atgaagtcgctgggagtggagcacaagaccatatcggagatcctggccgcaggtccctgc
cccaaggtgtggacatccatcgaggatgccatcaagcgcgccaacaaacagtccatttcc
aatgcccagaaggtgcagaagttcaccattctgccgcacgacttctccattcccaccggc
gaacttggacccaccctgaaggtcaagcgcaacgttgtgtccaagatgtatgccgatgag
atcgagaagctatatgcctag

DBGET integrated database retrieval system