KEGG   Drosophila erecta: Dere_GG23916Help
Entry
Dere_GG23916      CDS       T01060                                 

Definition
GG23916 gene product from transcript GG23916-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
der  Drosophila erecta
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:der00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:der00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 947 aa AA seqDB search
MAEPLGVETKPVSNGNANGNAVGIAESASAVFQEKMKLQLEEPNEITAVPKYGLKLKFDH
VWPEKRIQNVRASIRQTLPMVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIG
GIGGGTIGRGYAGEFCRFQMRPGIYEYNVVQANQFIVTIKDPKGCTIFQSLLSKCSTRDK
TSDPDADPDGERTKCQLPNCSSRAKQPLSAWHSNIEDSRCSYTGLYPRSWTEYDLSHYGV
RLICRQVSPVIPHEYRESSLPCAVFVWSVENVCDQERKVSITFSFKNGTGNKKQDAEGGA
ESQLISEGNAKGVSIRQKIAEMPCSYNLACRVLPEISITRCPQFDPAGNGEPLWAQLKEH
GQLSEQPTSEALKTKDIGVAVCAQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYYT
KYFDDSGDAGPKICEYALRQYSTWERLIDAWQRPILNDESLPDWYKCAIFNQLYFISDGG
TIWLKCDSSLGKELAYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVS
LQYDFKDAIAAELGDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDW
KDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYELYSQDNKRKNSADEK
QQNRKSASMYINETNGKVYLMDAIGYLKAMYAPCKAIMERTIEYDKDNDGLIENTKMPDQ
TYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLDEKLWNGS
YYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNI
GAANGFIANAGEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKT
LSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRAQRD
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacctttgggagtggaaaccaagccggtgagcaatggaaatgccaatggaaac
gcggtgggaatcgccgagtccgccagtgccgtcttccaggagaagatgaagctccagctg
gaggagcccaacgagatcacggcggtgccgaagtacggactcaaactgaagttcgaccac
gtgtggcctgaaaagcggatccagaatgtacgggcctccatcaggcaaacgctgcccatg
gtgcccctcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgtcgg
gtgtatatggactactactacatggagaacggcaagcagatctatggagtgcccatcgga
ggaatcggcggcggcaccattggaaggggctatgccggcgagttctgtcgattccagatg
cgtcccggcatctacgagtacaatgtggtgcaggccaatcagttcatcgttaccatcaag
gatcccaagggatgcaccatctttcagagcctcctctcgaagtgcagcaccagggacaag
accagcgatccggatgccgatccggacggggaaagaactaaatgtcaactgcccaattgc
agcagtcgagccaagcagccgctgagtgcctggcactcgaacatcgaggactcgcgctgc
agctacacgggcctctatcctcgctcctggacggagtacgatctgtcccactatggagtg
cgtttgatctgtcgccaggtatcgccggtgatcccacatgagtaccgtgagtccagcctg
ccctgcgcggtcttcgtttggagcgtggagaatgtctgcgaccaggagcgcaaggtatcc
atcacgttcagtttcaagaacggcacagggaacaaaaaacaggatgcggagggcggtgca
gagtcgcagctaatcagcgagggcaacgccaagggtgtctccatcaggcagaagatcgct
gaaatgccctgcagctataacctggcatgcagagtccttcccgagatcagcatcacgcgg
tgcccccagttcgatcccgccggcaacggagagccactgtgggcccagctcaaggagcac
ggccagcttagcgaacagcccacctcagaggccctaaaaactaaagatattggcgtggct
gtctgtgcccaggtggctctgaagcccatggcgtcccacgacctggagtttgtgctggcc
tgggacatgccgaagattcagttccccaggaagatgcagacccacacgcgctactacacc
aagtacttcgatgacagcggagacgcgggtcccaagatttgcgagtatgcacttaggcag
tattccacctgggagcggttgatcgatgcctggcaaagacccattctcaatgatgagagc
cttcccgactggtacaagtgcgccatattcaatcaactttacttcatctcggacggcgga
accatttggttgaaatgcgactcttcgctgggcaaggaactggcatatgatgatccgcgt
ctggcttatggccgcttcggttacctagaaggccacgagtaccgcatgtacaacacctac
gatgtccatttctatgcatctccggcactggctcacttgtggcccaatcttcaggtcagt
ctgcagtacgacttcaaggatgccatagccgcagaactaggcgatacccgtaaaatgctt
tacgatggcaaggtgatgccgcgcaaggtcaagaattgtgtgccccacgatctcggggat
cccgatgaggagcccttcaccctgataaactgctacaacattcacgatgtgaatgattgg
aaggatctcaatacgaagtttgtgctgcaggtctatcgggattactatgtcctcaatgaa
ctggcccaggctcaggcagataatgccagcaagttcagctccatcgagtttattgataag
gagagtctttatgagctgtacagccaggacaacaagcgcaagaattctgctgatgaaaag
caacaaaaccgtaagtctgcatcgatgtacatcaacgaaacaaatggaaaggtgtatctt
atggacgccattggctatttgaaggccatgtacgcaccgtgcaaggccatcatggagcgg
accattgagtacgataaagacaacgacggtctgatcgagaacacgaagatgccggaccag
acctacgactcctgggtgatggacgggccaagtgcctactgctccggtctctggctggct
gccctgcaagccatgtccgccatggctacaattctggaccagccgaatgattgtctgcgc
tatcaggatattctggagaagggcaagcgatcgctggatgagaagctctggaacggcagc
tactatcgctttgatctttcgcacagtcaccgggatacgatcatggccgatcagctatgc
ggtcattggtatctaaagtcctgcggcttcgattacgaaatctatccgaaggagaatgtg
cgtactgccctaaagaggatctatgacaacaatgtgatgggctttcatgagggcaatatc
ggagcggccaacggctttatagccaacgccggcgaacccaccaagccgggtcacgtggac
aacagcaacatccaggcggaggaggtgtggccgggggtggtgtacgctctggctgccacc
atgatacaggagggcatgttcgaggaagccttccaaaccgccggcggaatgtacaagacc
ctctcgcagcgcatcggcatgaacttcgagaccccggaagcgttgtacggggaaaagcgc
taccgctccattggctatatgcgccctttgagtatttggtccatgcaggtggcattggag
cgacggcgcgcccaacgcgactaa

DBGET integrated database retrieval system