KEGG   Drosophila erecta: Dere_GG23948Help
Entry
Dere_GG23948      CDS       T01060                                 

Definition
GG23948 gene product from transcript GG23948-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIDVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSHDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSEILGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPMDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMDVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatattgatgta
aacaccgacgaggaacctatattgtttaaggctcagttgtttgccctcactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctcaaggatgatcagtggaacctg
cagatcaaggacggcgctgtggtcttgttgctgggcagcaaggaaagtgttccagaagtg
cccgccactccggtcaaattcattgaggacatgaatgaagctgaagcagccacagcgatg
cgtcttccggctgggctgacaaatctgggcaatacatgctatatgaacgccactgttcag
tgcctaaatgcagtgcccgagctccgcactgccctgagcactttcagtcatgatggaacc
gacactatgtcgaccgcattttccatatcgtctgccatgaagtctatatttgctcaaatg
gagaagggcacaaccgttacgccaattgtgttgctgcaggcattgcaccgagcatcaccg
caattcgctcagactggcgaaaatggcacatacaggcagcaggacgccaatgagtgctgg
gcggaaatcctgaaaatgttgcagcaaaaactgcggccaacaaaccaggaaccatcgaat
actgtccagaaaaggcacagctcgtttatcgaccaattttttggtggcacttttgaagtt
aagatgagctctgaagaggatcccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttcaatggatgtgaagtacatgcagagcggactgaaatctaaa
atgaaagagcagctggtaaaaaaatcggaaatcctaggacgtgatgcaaagtacattcga
acttacttggtgagccgacttccagcctatctcaccgtacaattcgttcgctttcaatac
aaaggaaaggaaggcataaatgccaaggtgttgaaggatataaaattccctatggatttt
gatgcctttgagctgtgtactcccgaattgcaaaacaagctctgtccaatgcgctcgaaa
ttcaaggatctggaagacaagaaaatggatgttgacgttgtcaaacgcaatgaacccaac
gaggagaaaaaggacgtcaagtacgagcagttctggttcgacgacgatttgggcagcaac
aattcgggatactatacgctacaggcggtgctcacgcacaagggtcgttcgagttcatcg
ggccattatgtggcctgggttcgctccagcggcgatgtgtggttcaagttcgatgatgat
gaggtctccgcagtggccacggacgagatcttgcggctttccggtggtggagactggcat
tgcgcctacgtcctgttatatgcacccaggcgtttggagaaactataa

DBGET integrated database retrieval system