KEGG   Drosophila erecta: Dere_GG23954Help
Entry
Dere_GG23954      CDS       T01060                                 

Definition
GG23954 gene product from transcript GG23954-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 640 aa AA seqDB search
MNSKSDYEAEKDKKLTITNRFGDSLENYELSNESEHKTRVYPKKIPNRKNGILKNSEANH
SAVENSLLEDVDLADILGTNWPKRAGPAAMILNNKSKTDPSNCEDIILKPASPTLTKIEP
EEPLRFTIADYQPLIEIPGTELAIGSLVEVSNPGVCEDLYGVIRWIGIPPGPQKNVLVGI
EIEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNTISANRVSSN
HTKKFGVADCPAIYGSIPPLEIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSV
FDSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLT
CEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHS
SDIKLKVVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEFECR
DCFGSLQAGSGLECTAFCPKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYME
LFAVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLSEE
GARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaatccgattatgaagcagaaaaagataaaaagctgaccattacaaataga
ttcggggattccctggaaaactatgaactatccaacgagagtgagcacaagacccgtgtt
taccccaaaaagattcctaacagaaaaaacggaattttaaaaaacagcgaagccaaccat
agtgcagtagaaaattcacttctcgaggatgtggacttggcagacattttgggcactaat
tggccaaaacgagcgggaccagctgcaatgatcttaaacaacaaaagtaaaacggatcct
agtaattgtgaagacattattttaaaaccagcctctcccacattaacaaaaatagagcca
gaggaacctttacgttttacaatcgctgattaccaacctctgattgaaatacctggaacc
gagctagcgattggttctctggtagaagtctcgaatcctggagtatgtgaagatttatat
ggcgttataagatggataggtattccacctggccctcaaaaaaacgtactcgttggaatc
gagatagaagacgaatccaacttgaaaaatgttgtggcatcggatgggagacacaatggc
gtacgcttatttacttgccatgatggtcgagctatttttgtaccagccaacagatgcacc
gctgaccggcgatttgctgatgtagataataccatttctgcaaaccgagtttctagtaat
cacacaaagaaatttggtgtcgctgactgtcctgctatatatggctctattccaccatta
gaaatacacaactccgacgagcttgcaagcatatgtggaaagttcaaaggaatacaagga
caccacaattcctgctaccttgatgcaactctattttccatgttcaccttcaccagtgtt
tttgattcaattctgtacagacgtccgggcccacaagatattcgaaattacagtgaggtc
cagaaggttttgcgcgatgaaatcgtcaatccattgcggaaaaatgttttcgttcgatcc
gatcgtgtgatgaaactgcgagagctcctagatcagctaagttcggtcagcggtctaacc
tgcgaggaaaaagatcctgaagagttcctaaatagtttgctctcacaaattatgcgggtt
gaaccgtttttaaagttaagctcgggacaggattcatatttttaccaactatttgtggag
aaggatgagaagttaacattaccgagtgtgcaacaattgtttgaacaaagcttccactca
tcggatataaaactaaaggtggttccttcttgttttatcattcaaatgcctcgtttcgga
aagaactataagatgtatccaagaatattgccatcgcaggttcttgatgtcacagatata
attgaaaattctcctcgacagtgctcactttgtggcaaacttgctgaattcgagtgccgt
gattgttttggtagcttgcaggctggatcaggactcgaatgcaccgccttttgtccaaaa
tgtctgaaaactttccacagtcacatcaaaagaacaaatcatgtgtcgaaaaagatttat
agtccaaaggaatttaaaattatggccgagcatatggttgtcccgcgattgtacatggag
ttattcgcagtcgtttgcatagaaacgtctcattacgtggcgttcgtcaagtctggatcc
ggacctgatgctccatggtgtttcttcgattcaatggctgataggaaaggcgaacaaaat
ggatacaatatacctgaaattacgtgtgttccagaattaacccagtggctctcggaagaa
ggcgcacgatctataaatgaaacttcaacgaacgataaagtattacctgaacacgctaag
cgtattttttgcgatgcctatatgtgtctgtaccaaagcacagatattatgatgtaccat
tag

DBGET integrated database retrieval system