KEGG   Drosophila erecta: Dere_GG23965Help
Entry
Dere_GG23965      CDS       T01060                                 

Definition
GG23965 gene product from transcript GG23965-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:der04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:der04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 948 aa AA seqDB search
MASISDDGMALSGYLKKLKTMKKKFFVLYEETSNSSARLEYYDTEKKFLQRAEPKRVIYL
KNCFNINRRLDTKQRFVIVLSSRDGGFGIVLESENDLRKWLDKLLVLQRNIANTNGTAYS
PYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPDKTPNGEERVASIEILLTT
IRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAVATNMHNTILSAMSAKTESNTNLI
NVYQNRPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLDLRSCSSPHNYGFGRERCDS
LPTRNGTLSESSNQTYFGSNHGLRSNTISGIRPHSSNKHSNSPTFTMPLRCSASEESSIS
IEESDDNGSFSHYRLNTRSSETAIPEENIDDFASAEFSKVSEQNESDENYIPMTPINPTD
AIHEKEKVDMQRLEDGSLHFDFPEHASEKLARDFDLDSDNQCGRPIRAYSIGNKVEHLKF
NKRLGHLNDTGQNPNRVRAYSVGSKSKIPRCDLQRVVLVEDNKHEFAANRSQSSITKEGT
SYSTSSNRQKKSTSAPLLSLKNHINSDRMSDLMEIDFSQATNLEKQKFIKNNEIPKYIEN
VFPKTPRTDSSSLTLHATSQKDIFNGTKLNNTVNASEEGYLEMKPVGNAYTPSSNCLPIK
VEKLKISDYTAPLTTAAPVHDLNKISAYNISAEKWKEQSLCEEKKSNSPLNETPCSLKPT
DVESNSHDEHSTNNMECEVSVQCDKQNNLDDKVAENNNLDIGGHEEKKLVHSISSEDYTQ
IKDKSNDFTKFNEAGYKILQIKSDSSLISLKLYQKGIHKDNLERSHRLTESVNTIPDNAT
ASSSVTKFNINTKAADSRSTDPSTPQNILQIKDLNFPSRSSSRISQPELHYASLDLPHCS
GQNPAKYLKRGSRESPPVSACPGDGNTYAKIDFDQSDSSSSSSNIFNT
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatttcggatgacggcatggcgctgagtggctacctcaaaaagctgaagacc
atgaagaaaaagtttttcgtgctgtacgaggagaccagcaattcatcagcccgtctggaa
tactatgatacagaaaagaagttcctgcaaagagccgagcccaaaagggttatctatctg
aagaattgcttcaacataaatcgccgcttggacacaaagcaaagatttgtcattgtactc
tcctccagagacggtggattcggtatcgttctcgagagcgaaaatgatttacgcaaatgg
ctggacaaactactcgtcctacaaaggaacatagccaatacgaatggaacggcgtactcc
ccttatgaccaagtttggcaagttgtcattcaaaagaagggtatttcggagaaagttgga
atcaccggaacctatcactgttgccttacttcaaaatccctgacattcgtgtgtatagga
ccggataagactcccaatggcgaggaacgcgttgctagcattgaaatacttttgaccacg
atcaggcgatgcggtcatgcatccccacaatgtattttctacgtggagctcggccgtcaa
agtgtcttgggatctggcgatctgtggatggaaacggataacgcagctgttgctactaat
atgcacaatactatactgagcgctatgtcagctaaaaccgagtcgaacacgaatttaata
aatgtttatcagaacagaccagacttgagtcacgagcccatgagaaagcggtcatcgtct
gcaaatgaagcttcgaagccgataaacgtaaacgttatacaaaatagtcaaaactctctt
gatttgcggagctgcagttcgccccataactatggttttggaagagagagatgcgacagc
ttaccgaccagaaatggaaccctaagcgagtccagcaatcaaacgtactttggttccaac
catggactgcgatccaacactatatctggcatccgtccgcactcatccaacaagcatagt
aatagtccaacgttcaccatgccattaagatgctcagcatctgaagagtcatcaattagt
atcgaagaatccgacgacaacggaagttttagccactacagattaaacacgcggtcatcg
gagacggctattcctgaggaaaacattgatgactttgccagtgcggaatttagcaaagtc
agcgaacaaaatgaaagtgacgaaaactacataccgatgactccaattaatcctaccgat
gctatccatgaaaaagagaaggttgacatgcaaaggttagaagatggatctctacacttt
gactttccggagcacgcgtcggaaaaactggctagggattttgatctggactctgataac
caatgcggacgtcccattcgtgcgtattcgataggaaacaaagttgagcatttaaagttt
aataagcgcctgggacatttgaatgatacgggacagaatccgaatcgcgtacgagcctac
tcagttggttccaagtcgaagataccgcgttgcgacttgcagcgagtggtcctcgtggag
gataataaacatgagttcgcagcgaataggagtcagagtagcattacaaaggaaggcact
agctatagcacaagtagcaaccggcaaaagaaatctacaagtgctcctctccttagtcta
aagaaccatataaactcagaccgaatgagtgacttaatggaaatagatttttcacaagca
accaatttggaaaagcagaaattcatcaagaacaatgaaattccgaaatacattgaaaac
gtgttcccaaaaacccccagaaccgatagctccagcttaactctgcacgccacaagtcag
aaagacattttcaatggaaccaaactaaataacactgtgaacgcatccgaggaaggatac
cttgagatgaagccagtcggtaatgcatacactcccagttcgaattgccttccaattaaa
gtagagaagctcaagatatcagactacaccgcaccactcacaacagcagcaccagtgcac
gacttaaacaaaattagtgcatacaatatatccgctgagaaatggaaagaacagtcctta
tgtgaggagaaaaagtcgaactccccattaaatgaaacaccctgtagcttgaaaccaaca
gatgtcgagagtaacagccacgatgagcattcaacaaacaatatggagtgtgaggtgtcc
gtgcaatgcgacaaacaaaataatttggatgacaaagttgctgagaacaacaatttggat
attggcggccatgaggaaaagaaattggttcattcgataagcagcgaagactacacacaa
attaaagacaaatcgaatgacttcacaaaatttaacgaagccggctacaaaattcttcaa
attaaaagcgacagctcactcatctcattgaagctgtaccaaaagggtattcacaaagat
aacttggaacgatcgcatagacttacggagagtgttaatacgattcctgataatgccacc
gccagcagctcagtcaccaaattcaatataaacacaaaagccgcagactctcgaagcaca
gatccaagtacaccacaaaacattcttcagatcaaagatttgaatttcccgtcaaggtct
tcgtctcgcatatcccagccggagctgcactacgccagcctagatcttccccattgtagc
ggccaaaacccagctaaatacctgaaaagaggttcccgcgaatctccgcccgtgtctgca
tgcccgggggatggaaatacctatgcgaaaattgactttgaccaatccgactcctcttcc
tcctcatcaaacatatttaatacgtaa

DBGET integrated database retrieval system