KEGG   Drosophila erecta: Dere_GG24016Help
Entry
Dere_GG24016      CDS       T01060                                 

Definition
GG24016 gene product from transcript GG24016-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
der  Drosophila erecta
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dere_GG24016
   04340 Hedgehog signaling pathway
    Dere_GG24016
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dere_GG24016
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dere_GG24016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 485 aa AA seqDB search
MREEEEAALRNTKSILQFLKKKKSHHSSTSGEGKLQAQSSCEEEGGAAAGGAAAAAGPPA
DQASSSSSGPSSAAAAHKSTPPAATTTPGSGADSGGASGGGGGGPSSSGDDQAQVSASAT
FRLSSLTGTISKMGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFER
IKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVS
LRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYR
DLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALG
VLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLK
AGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAK
EFAEF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggaagaggaagcagcactgcgtaacactaagtccattttgcagttcctcaaa
aagaaaaagtcccatcatagttccacatccggcgagggcaagctacaggcgcagtccagt
tgcgaggaggagggcggagcggcagcgggaggagcggcagcggcagcgggacctccagcg
gaccaggcaagcagcagcagcagcggcccctcgtcagcagccgccgcccacaagagcacg
ccccccgccgccacgaccacgcccggttccggggcggattcaggaggagccagcggagga
gggggaggaggacctagtagctccggcgacgatcaggcccaagtgtcggccagcgcaacg
ttccgtttgtcatcgctaacgggcaccatctccaagatgggcaacaacgccaccacgtcg
aacaagaaggtcgatgccgccgagacggtgaaggagttcctcgagcaggccaaggaggag
ttcgaggacaagtggcgacgcaatccgaccaacaccgccgccctcgatgacttcgaacgg
atcaagaccctgggcaccggctcctttggccgtgtcatgatcgtccagcacaagcccacg
aaagactattatgccatgaagatccttgacaagcagaaggtggtcaagctgaagcaggtg
gagcacacgctgaacgagaagcgaatcctgcaggccatccagttccccttcctcgtctcg
ctgcgctaccacttcaaggacaactccaacctctacatggtgctggagtatgttcccggt
ggcgagatgttctcccacctgcgcaaggtgggccgcttctcggagccgcactcgcgcttc
tatgcggcgcaaatcgtgctggccttcgagtacctgcactacttggacctcatctaccgt
gatctgaagccggagaatctgctgatcgactcgcagggctacctcaaggtgacggacttc
ggtttcgccaagcgggtcaagggccgcacctggacgctgtgcggcacgcccgaatacctg
gccccggagatcattctgtccaagggttacaacaaggccgtcgactggtgggcgttgggc
gtactcgtctacgaaatggccgccggctatccgccgttctttgcggatcagccgatccag
atctacgagaagatcgtctccggcaaggtgcgcttcccgtcgcactttggctccgatctg
aaggacctgctgcgcaacctgctgcaggtggatctgaccaagcgctacggcaatctgaag
gcgggcgtcaatgatattaagaaccagaagtggttcgcctccaccgactggattgcgatc
ttccaaaagaaaatcgaggcgccgttcattccgcggtgtaagggtcccggcgacacgagc
aatttcgatgactacgaggaggaggcgctgcggatctccagcaccgagaagtgtgccaag
gagtttgctgaattctag

DBGET integrated database retrieval system