KEGG   Drosophila erecta: Dere_GG24047Help
Entry
Dere_GG24047      CDS       T01060                                 

Definition
GG24047 gene product from transcript GG24047-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
der  Drosophila erecta
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:der00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 388 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDV
NDAHHSHDLMEMSGPEQDVGGHEHVHENATIAERLYSEVRVLCWIMTNPSNHQKKARHVK
RTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKA
DDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEAL
PNPKLCKEENSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFW
YWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPEALPNKLAVG
ELMPQIKDQEAESTSGGVSKRSAETKTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacagtctgctaggaaggtccatactcaatgaagggcgctcaaacaagcga
tcatttgtgtccctgatcgtgggcctgatcgtgggcttctgcctggcggagctgttcgtc
tactccacgccggagcggagtgaattcatgccatacgatggccatcggcatggcgacgtg
aacgatgcccaccacagccacgacctgatggagatgtctgggccggaacaggacgtgggt
ggacacgagcacgtgcacgagaacgcgacgatagcggagcgactgtatagcgaggtgcgg
gtgctctgctggatcatgaccaatccgagcaaccatcagaagaaggcgcgccacgtgaag
cgcacctggggcaagcggtgcaacaagctgatcttcatgagctccgccaaggacgacgag
ctggacgcagtggctctgcccgtgggcgagggccgcaacaacctgtggggcaagaccaag
gaggcctacaagtacatctacgagcaccacatcaacgacgccgactggttcctgaaggcg
gacgatgacacctacacgatagtggagaacatgcgctacatgctctatccgtacagtccg
gaaactccagtctactttggctgcaagttcaagccgtacgtgaaacagggctacatgtcc
ggcggtgccggatacgtcctcagccgggaggctgtgcgtcgctttgtggtcgaagccctg
ccgaatccgaagctgtgcaaggaggaaaactcgggtgccgaggacgtcgagattggcaaa
tgcctgcagaatgtaaatgtgctcgctggggactcgcgcgactcaaacggtcggggtcgc
ttctttccatttgttccggagcaccatctgattccatcgcacacggacaagaagttctgg
tactggcagtacatcttctacaagacggatgagggacttgactgctgctcggacaacgcc
atatccttccactacgtctcccccaatcaaatgtatgtgctggactatctgatctaccat
ctgaggccgtacggcatcataaacacacccgaagcattgcccaataagctggccgtgggc
gaactgatgccgcagattaaggatcaggaggcggaaagtacgagtggtggcgtctccaag
agatccgccgagacaaagacgcaataa

DBGET integrated database retrieval system