KEGG   Drosophila erecta: Dere_GG24141Help
Entry
Dere_GG24141      CDS       T01060                                 

Definition
GG24141 gene product from transcript GG24141-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:der01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:der01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:der00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:der00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:der00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:der00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 950 aa AA seqDB search
MHSIKFRVLNKLNPLFFKINGRIQQCHQFHGPTTFRFRNSIKTPPIRQKLTFPSIDIHCT
RSHNLCSPRDISGNTLLNVKFNWNRNVIQSHSYSGDQKNDSPSDKNKKDDKLVQICGKPL
KNVHNGFLNASNYSEKNVRKNKKSVPKKRCGKSLEELRKCLRTMQDVIDFVHPIKPFKDK
GLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSI
IHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLL
DELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTA
YSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAGQR
LNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILACRM
GAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGR
SFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYR
GDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFK
IQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEI
TEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDV
YHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPT
PFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIA
ETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaataaaatttcgagtattaaacaaattaaatcccttattttttaaaattaat
ggacggatacaacaatgccaccagtttcatggacctacaacatttcgctttagaaactca
atcaaaacacccccaattaggcaaaagctgacttttccaagcatcgacatccattgtact
cgaagtcataatttgtgtagtccccgagatatttcaggaaatactcttttaaatgtaaaa
tttaattggaatcgaaatgttatacagtcgcacagttattccggtgatcaaaagaatgat
agtcctagcgataaaaacaaaaaagatgacaaacttgtgcaaatatgtggaaaaccatta
aaaaatgtgcacaacggatttctcaatgctagtaattattctgaaaaaaatgttagaaaa
aacaaaaagagtgtaccaaaaaagcgatgtggcaagtcgctagaagagctgcgaaagtgt
ttgagaaccatgcaggatgttatagattttgtgcatccaatcaagccttttaaggacaaa
ggactggcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtccgagcc
tgtgtgcgtatggccatctatttgggctgcaaggtctacttcatccgtgaaggctaccag
ggcatggtagatggaggtgactgcatccaggaggctaactgggcctcagtctcgtccatc
atccatcgtggtggtaccatcattggctccgcccgttgccaggacttccgtgagcgtcag
ggtcgcttgaaggccgccaacaacctgatccagcgtggaatcaccaatctggtggtcatt
ggaggcgatggctccctcaccggcgccaatctgttccgtcaggagtggtccagtctgctg
gacgagctggtcaaaaacaagaccattaccaccgagcagcaggagaagttcaatgtcctg
cacatcgttggattggtgggctccattgacaacgatttctgtggcacggacatgaccatc
ggcacggacacggccctgcatcgcatcatcgaggccatcgatgccatttccagtaccgcc
tactcgcatcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctatttagct
cttgtgggcggactggcgtgcgaggcggatttcatattcattcccgaaatgccgcccaag
gtcgattggccagacaggctctgctctcagctggcccaggagcgatctgctggccagcgc
ctgaacatcgtgatcgtcgccgaaggagccatggatcgcgagggtcatcccatcaccgcc
gaggatgtgaagaaggtgatcgacgagcgtttgaagcacgatgcccgcatcactgtcttg
ggtcacgtgcagcgcggtggcaatcccagtgccttcgatcgtattttggcttgtcgcatg
ggagctgaagccactttggccctgatggaggccaccaaggactcggtgccagtggtcatc
tctctggatggcaaccaggcagttcgcgtgccgctgatggagtgcgttgagcgcacccag
gctgtggccaaggccatggcggagaaacgctgggcggatgctgtcaagctgcgcggacgc
tccttcgaacggaatctggagacctacaagatgctgacgcgcttgaagccacccaaggag
aacttcgacgccgatggcaagggcatcgaaggataccgcctagctgtgatgcacattggt
gctccagcttgcggtatgaatgccgctgtgcgcagtttcgtgcgaaatgccatctaccgc
ggtgatgtggtttatggaatcaacgacggtgtcgagggtctgattgccggtaatgttcgc
gagctgggctggtccgatgtctcaggatgggttggtcagggtggcgcctacttgggcacc
aaacgcactctgcctgagggcaagttcaaggagatcgccgctcgtctcaaggagttcaag
atccagggtcttctgatcatcggtggctttgagagttaccatgccgccggacagatcgcc
gatcagcgggacaactacccacagttctgcatccccattgtggttattccatcgacgatc
tcgaacaatgtgcccggcacagaattttcgctgggatgcgacaccggtttgaatgagatt
acggagatttgcgaccgtatccgtcaatcggcccagggcaccaagcgccgcgtgttcgtc
atcgagacaatgggtggctactgcggctatttggccaccttggccggtttggccggcgga
gctgatgccgcctatatctacgaggagaagttctccatcaaggacctgcagcaggatgtc
taccacatggcctccaagatggccgagggcgtctcccgcggtctgatcctgcgaaacgag
aaggctagcgagaactacaccacggacttcatttaccgcctgtactcggaggagggaaag
ggtctcttcacctgccggatgaacatcctgggtcacatgcagcagggcggctcacccact
cccttcgaccgcaacatgggcaccaaaatggccgccaagtgtgtcgactggctggccacc
cagatcaaggcgaacattgacgccaacggagtggtcaactgcaagtccccggacaccgcc
accctgctgggtatcgtgtcgcgacagtaccgcttctcaccactggtcgacctcattgcc
gagacgaacttcgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctg
ctgcgtatcctggccaagcacgactccgcctacgaggaggagggtatgtacatcaccgtc
gaggaggagtgtgacaccgacgccgtcgcctaa

DBGET integrated database retrieval system