KEGG   Drosophila erecta: Dere_GG24265Help
Entry
Dere_GG24265      CDS       T01060                                 

Definition
(RefSeq) GG24265 gene product from transcript GG24265-RB
  KO
K05759  
profilin
Organism
der  Drosophila erecta
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dere_GG24265
Cytoskeleton proteins [BR:der04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dere_GG24265
Exosome [BR:der04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dere_GG24265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVSKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccagtggctttgaggtgtcaaaa
gaggagctctccaaactgatcagcggcttcgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctttccggcacagaccgcgtggtgcgcgcc
aagctcggccggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagccccagcaggctgcttccgtcgtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system