KEGG   Drosophila erecta: Dere_GG24410Help
Entry
Dere_GG24410      CDS       T01060                                 

Definition
GG24410 gene product from transcript GG24410-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:der00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dere_GG24410
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG24410
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG24410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 895 aa AA seqDB search
MAKLKKLHMSSNMEDLEKMSIIPDLRNKGMKILLNTARKLYMTAEEYRLDGDEELAYITY
MKYFNMLTAIHKKSDYASHKTTVRQMLGDTDSNRRIMDTLEVIINSLRHRYAQQRQEPEP
IPLDLVSNGGVSLDSPISPPTQYARLGLITCQDLYRRMQEKSVLVMDCRPSTDYDASHLT
YYCAFNVPEELITPGMSAGRLQARLSSSGKASWASRSVKDSVVLMDWNTKDAQPAADTAI
STLLDILKNWDPDVTYRAPIQIVEGGYEYFIMMYPTHSTNPSVQAPQQNNNDIETIDDIE
YPSIHDITMKEDISAKDFRPRPDINRANKPAATRTYDQGISRVSPPAKPIAEILRDQAEF
LQRAEQNDEQLEKASKMWKRQAAEGDGLNATEDQELHFRILQLESKAQDYIVENNRLREE
LTRIQELHNVTQQLSQKEVEATRNIESKIRERQRLDEQHELERQERERLLAIARETKKHY
KSPPPSGPPSPDRHLENLQVVSDSLESLLQLTGEDPPIAQNKVERPTFDRAMKPQPRNVE
RTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYIS
RSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILM
DWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESAT
YESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHGWNCPSCKTKRDAIKKLDISKLPPVL
VVHLKRFYADPSNSGAYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYG
TMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFYTWLPPMQVSL
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttgaagaagctgcacatgagctccaacatggaggacctggagaagatgtcc
atcattccggatctgcgcaacaagggcatgaaaatcctgctgaacaccgcccgcaaactg
tacatgaccgccgaggagtacagactggatggcgacgaggagctggcctatatcacctac
atgaagtactttaatatgctgaccgcgattcacaaaaaatccgattacgccagccacaag
acgacggtgcgtcagatgctgggcgacaccgactcgaatcgccgcattatggacacgctg
gaggtgattatcaactccctgcggcatcgttatgctcagcagcgccaggagccggaacca
attcctctcgacctggtcagcaatggaggtgtaagtctggactcgccgatatcaccgcca
acgcagtacgcccgacttgggctgatcacctgtcaggatctgtatcggcgcatgcaggag
aaatcggtcctagttatggactgtcgcccaagcaccgactacgacgcctcccacctcact
tactactgtgcatttaatgtgcccgaagagttgataacgccaggaatgtcggctggcaga
ttgcaggctcgtctcagcagcagcggcaaggcatcgtgggcatcgcgttccgtcaaagat
tcggtggttcttatggactggaacaccaaggatgcccaaccggcggccgatacagccatt
tcaaccctgctcgacatcctgaagaactgggatccagatgtgacttaccgcgcacccatt
cagattgtcgagggcggttacgagtacttcattatgatgtatccaactcattccactaat
cccagtgtgcaggcgccgcagcagaacaacaacgatattgagaccatcgatgacattgag
tatccctcaatccacgacatcaccatgaaggaggatattagtgcgaaggacttcagacca
cgaccagacatcaatcgggccaacaaacccgcggccactcgcacttatgaccagggaatt
tcccgtgtttctccgccggctaagcccatcgctgagatcctgcgtgatcaggctgagttt
ttgcagcgggcggagcagaacgatgagcagttggagaaggcctcaaaaatgtggaagcgt
caggcagcagagggcgatggtttgaatgctaccgaggaccaggagttgcacttcaggatc
ctacagttggagagcaaggcccaagactatatagtggaaaacaatcgactaagagaagaa
ctaactcgcatacaagaactacacaatgttacccagcagttgtcgcaaaaagaggtcgag
gcaacgaggaatatagagtccaagatccgggaacgacagcgtttggacgagcagcatgaa
cttgaaagacaggagcgggagcgtcttttggcgatcgctcgcgagactaaaaaacattac
aagtcaccaccaccttcgggaccgccatcaccggacaggcacttggagaacttacaggtc
gtgtcagacagcctagaatccctgctccagttaaccggcgaggatccgccaattgcgcaa
aacaaggtggaaagacctacattcgatagggcgatgaaaccgcagccgaggaacgtggag
aggacatcgcaacgcgttcgtgatttctcgcccgtcattggtcagaatgtgggtcgtggg
ctgactggtttaaagaatctgggcaacacctgctatatgaacagcattctgcagtgccta
agcaacacgcctcagttgacggagtactgcatctcggacaaatacaagaattacatcagc
agaagcaacaagaccaatgggcaagtgatcgaggaggtggctgcactcatcaaggagctt
tggaatgggcagtacaagtgtgtggctagccgagacttgaggtatgttgtgggccagtac
cagaagatcttccgcggcgttgaccagcaggactcacacgaattcctcactattctgatg
gactggctgcactcggatctccagaccctacacgtgccccgtcagcgcgagatgatcagt
gcgtcggagaaggcttggctggaatttaccaaggcgaaggagagcatgattctgcattta
ttctacggtcaaatgaagagcactgtcaagtgtgtggcctgtcacaaggagtcggccacg
tacgagagcttttctaatctcagcctggagctgccgcccaactcaaatgtgtgccagctg
aaccagtgcatggacatgtactttagtggagaacggatccatggctggaattgtcctagt
tgtaaaactaaaagagatgccattaagaagctggatatatctaagctgccacctgtactg
gtggtgcatctgaagcggttctatgcggaccccagtaattccggtgcctacatgaagaag
caaaactacctgcgcttccccctggagaatctggacatgaatccctacatagcacgggcg
gaatcgcgggcggtaacgcccaagacctaccagttgtacgccgtttccaatcactacgga
actatggaaggcggccattatacggccttttgcaagagcgccaactacggaaagtggttc
aagttcgacgatcaggtcgtctcagccctggactcctcgaacgttgtttccagcgccgcc
tacattctcttctacacctggctgccaccaatgcaggtgtcgctgtag

DBGET integrated database retrieval system