KEGG   Drosophila erecta: Dere_GG24420Help
Entry
Dere_GG24420      CDS       T01060                                 

Definition
(RefSeq) GG24420 gene product from transcript GG24420-RB
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
der  Drosophila erecta
Module
cGMP signaling
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dere_GG24420
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dere_GG24420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1072 aa AA seqDB search
MRFCFDRLCFATKRPAQNSNSNAPHSSTTVDAPPRPADADVATAPVAPSPSPQPPPQQAV
SNLFYADYQKLQPAIIDRDWERDRDTDTRSEAKPPDIVEHIEPVEQQRQIQIPPPPPAPS
IQTQIQQRYRRHSSAEDRNLNTRRNDSNTTEALRKAASMQQEPNANYQFPTDLGLVSIVN
NNNTNTHPIGANSSSNSNNNNLVGGIVTLPAAGGLIGLEHTASGLRLIPAPPTHSEVLTH
TLIYGTPPSGAQQLNQDPRSLLHQQELQLQQRYQQLQQLQAQTQGLYTSQGSPVLYHQPS
PGSSQPVAIPGATCHSPTQLQPPTTLNLQQQMQSLRISGCTPSGSGGSATPSPVGLVDPN
FIVSNYVAASPQEERFIQIIQAKELKIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSRS
SAAGCAGTGGSGSGAGASGGSGPSTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHV
SFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSI
VYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQT
IMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFF
IISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVID
RETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQT
NGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLME
SCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVK
LVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFT
GSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWF
DGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgctttgatcggctgtgcttcgcaaccaagcggccagcccaaaactccaac
agcaatgcaccacacagcagcaccactgtagatgcaccaccacgtccagcggacgcagat
gtagccactgccccagtagcaccgtcaccatcaccacaaccaccaccacaacaggcagtt
agtaatctgttctatgccgactaccagaagctgcagccggcgataatcgatcgggactgg
gagcgggaccgagatacagataccaggagcgaggccaagccgccggacattgtagagcac
atagaacccgtagagcagcagagacagatacagatacccccaccgccccctgccccatcg
atacagacacagatacagcagcgctatcgccggcacagcagtgccgaagatcgcaatctg
aacacgaggagaaacgattcgaatactacggaggcgttacgaaaagcagccagcatgcag
caggagccgaacgccaactatcagttcccaaccgacttgggtctggtgagcatcgtcaac
aataataacacaaacacccatccgattggagccaacagcagcagcaatagtaacaacaat
aatctggtgggtggcattgtgaccttgccggcggctggtggtctcattggtctggagcat
acggcatcgggtctgcgactgataccagcgccgcctacccactcggaagtgctgacccac
accctgatctatggcacgccgccctcgggcgcccagcaactgaaccaggatcccaggagc
ctactgcaccaacaggagctgcagctgcagcagcgctatcagcaattgcagcagctccag
gcgcagacacagggcctgtataccagccaaggcagtccggtgctgtaccaccagcccagt
ccgggatcgagtcaaccggtggcgatacccggtgccacttgccactcgcccacgcaactg
cagccgcccacaacgctgaacctgcagcagcagatgcagagtctgcggatctcgggatgc
acgcccagcggttcgggtggttcggccacgccctcgccggtgggcctggtggatcccaat
ttcatcgtgagcaactatgtggccgcctcgccgcaggaggagcgcttcatccagatcatt
caggccaaggagctcaagatacaggaaatgcagcgggccctccagttcaaggacaacgaa
atagccgaactgaagtcgcacttggacaagttccagagtgtcttccccttcagtcgcagc
agtgcggcgggatgtgcgggcacgggaggatcgggttccggagccggcgcaagtggcggc
agtggtcccagcaccgccacaggcgccacccgcaagtcgggacagaatttccagaggcag
cgggcgctgggcatctccgcggaaccccagagcgagtcctcactgctcctcgagcacgtc
agctttcccaaatacgacaaggacgagcgctcccgtgaacttatcaaggctgccatattg
gataatgatttcatgaagaatctggatctgacgcagatccgcgagatcgtcgactgcatg
tatccggtcaaatatccagccaagaatctgatcatcaaggagggagatgtcggaagcatt
gtttatgtcatggaagatggacgcgtggaggtttcccgcgagggcaagtacctctccacc
ctgtcgggcgcaaaggtccttggcgaactggcgatcctgtacaactgccagcgaacggcg
accatcaccgcgatcaccgagtgcaatctgtgggccatcgagcgccagtgcttccagacc
atcatgatgcgaacgggcctgatccggcaggcggagtacagcgacttcctcaagagtgtg
cccatcttcaaagacctggcggaagacacgctcatcaaaatctccgatgtcttggaggag
acgcactaccagcgaggcgactacatagtgcgccagggcgccagaggcgataccttcttc
atcatctccaagggaaaggtgcgggtgacgatcaagcagcaggacacgcaggaggagaag
ttcattcgcatgctgggcaaaggggatttctttggggaaaaggctctacagggcgatgat
ctgcgcacggcgaatattatttgcgagtccgccgatggcgtcagttgtctggtcatcgat
cgcgagaccttcaatcagctcatttccaatctggacgagatcaagcatcgctacgacgac
gagggcgccatggaacgcagaaagatcaacgaggaattccgggacatcaacctcacggat
ctgcgcgtcatcgcaacccttggagttggaggcttcggccgcgtggagctggtccaaact
aacggggatagctccaggtccttcgccctcaagcagatgaagaagtcgcagattgtggag
acgcgacagcagcagcacatcatgtccgagaaggagatcatgggcgaggccaattgccag
ttcatcgtgaagctgttcaagaccttcaaggacaagaagtacctgtacatgctgatggag
agctgcctgggcggagagctctggacgattctgcgggacaagggcaacttcgacgacagc
accacccgcttctacacggcgtgtgtggtggaggcctttgattacctacactcgcgtaac
atcatctaccgcgacctgaagccggagaacctgttgctcaatgaacgcggatatgtgaag
ctggtggacttcggctttgccaagaagctgcagacgggcaggaagacctggactttctgc
ggcactccggagtacgtggctccggaggtgattctcaaccggggtcatgacatcagtgcg
gattactggtcgctgggagtgctcatgttcgagttgcttactggtacccctccgttcacg
ggctcggatcccatgcgcacgtacaacattatacttaagggcatcgacgccatcgaattc
ccacggaatatcacccgcaatgccagcaacctgatcaagaagctctgtcgcgacaatccc
gccgagcgtttgggctaccagcgtgggggaatcagtgagatccagaagcacaaatggttt
gatggcttctattggtggggcctgcagaactgcaccctggaaccgcccattaagcccgcc
gtgaaaagcgtggtcgacacaacaaactttgatgactatccgcccgatccagagggtcca
ccaccagacgatgtcactggatgggacaaggacttctga

DBGET integrated database retrieval system