KEGG   Drosophila erecta: Dere_GG24465Help
Entry
Dere_GG24465      CDS       T01060                                 

Definition
GG24465 gene product from transcript GG24465-RA
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dere_GG24465
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     Dere_GG24465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1019 aa AA seqDB search
MADEAGTQADGKRQFICGVIEGFYGRPWTTEQRKDLFRKLKSMGMGSSPSYMYAPKDDYK
HRAYWRELYTVEEADHLSSLIAAAKEAGITFYYALSPGLDMTYSSPKEIATLKRKLDQVA
QFGCEAYALLFDDIESELSKADKEVFQTFANAHVSVTNEIYTHLDSPRFLFCPTQYCASR
AVPTVQESEYLNTLGSKLNNEIDILWTGDKVISKTISLESIQEITEVLRRPPCIWDNLHA
NDYDQKRVFMGPYSGRSPELIPHLRGVMTNPNCEFYGNFVAIHSLAFWSRCSLDSKVNSS
LSADIKLETENDDDLPAEFLSKNVYHPRVALKNAITEWLPEFFMKKEAWGPITKPQPQVQ
MVMPIIPIIPSINTCMSLTTTTTTSTSSRTVPPTVNTTQLQALADVCVVTSSLTPISNPV
MNSLVSPTKVITNDDIINPIPTTAASNIELPKKIPISVVPVPIMETKSVEASVELGLDNA
VFDDNEIEPNSDSVKERLELEVDIDEKQEPVANLSVDTMLDDDSLSPLSGVVNEPMECSS
SIASQVSPRDEEAIKVVADDVLMESVNDVHSMHVESGTSSPISNAEMREENEAQSDRTND
NNTIDCKGITVDDLVLLCDLFYLPFEHGSRGHKLLVEFNWLKINANVILQDRSAGGGGDA
MKAAKPEVSEWHQRREQFDHLCSAVVELLIKIANCQNKEICHELYSYVWDISGALSLLNC
YVKWLALGNFPQNTSSYTEGSYTWFSKGWKEAFMSGDQEPWVFRGGLIADLQRLMPVDSG
NDLFVYKLPEQPTANYYLLRPYCNSDEQQVNDLCTRLYLQWQGELDGGSHIPFPLPANVA
NIVADGMIGGHLTLSPQLCIVAYDENNSIIGYSCAALDVNIFRRNLEMCWYTELRGKYSR
DVCPQEGGEKVTQLVTSFVENFHDSSGNGALDPCPVEVSGSFPAVLISGTLREAEERDLG
ITKRMLTVLLAALRANGCFGAHVRVPQQDVAQVNFYSRIGFVDVYREEATKCVYMGRRF
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaagcgggcacccaagccgatggcaagcggcagtttatctgcggcgtgatc
gagggattctacggccggccgtggacgacggagcagcgcaaggacctgttccgcaaactg
aaatccatgggcatgggatccagtccttcctacatgtatgcgccgaaggacgactataag
caccgtgcctactggcgagagttgtacaccgttgaggaggcggatcacctgtccagtctg
attgcagcggccaaggaggcgggcatcaccttttactacgctctatcgcctggactggac
atgacttacagcagccctaaggaaatcgcaacgctgaagcgcaagctggatcaggttgcg
cagttcggctgcgaagcctatgccttgctctttgacgacattgagtcggagctctcaaag
gcggacaaagaggtcttccagacgtttgctaacgcccacgtatcggtcaccaacgagata
tacacgcatctggacagccccaggttcctcttctgccctacccagtattgtgcctcgcga
gcggtgcccacggtccaagaatcggagtacctaaataccctgggctccaagctgaacaac
gagatcgatatattgtggacaggggataaggtcatctccaagaccatatcgcttgagtcg
attcaggagattaccgaggtgctgcgccgcccgccgtgcatctgggataatcttcatgcc
aacgactacgaccagaagcgagtctttatgggaccttacagcggtcgatcgccggagctt
attccccacctgcgaggtgttatgaccaaccccaactgcgaattttacggcaatttcgtt
gccattcattcgctggccttctggtctcgctgcagcctggactccaaagtgaacagctcg
ctaagtgcagacataaagctggagactgaaaacgatgatgacctcccggcggagtttctc
tcaaagaacgtttaccacccacgagtggctctcaaaaacgctattacggagtggctaccg
gagttcttcatgaaaaaggaggcctggggacccattacaaagcctcagccccaagtccaa
atggtgatgcccattattcccatcataccctccattaacacctgcatgagtctcaccacc
acgacaaccacctcgacgagctcgaggacggttccacccacggtcaacaccactcaactt
caggctctggctgacgtttgcgttgtgacctcctcgctgactcctatctccaatccagta
atgaactccctggtttcacccacaaaagtgatcacgaacgatgacatcatcaatcccatt
ccgaccacagcggccagcaatattgaactgcctaagaaaataccgatatccgttgttcca
gtgcccattatggagacaaagagtgtggaggcttccgtggaactgggtttggacaatgcg
gtgttcgatgacaatgaaattgagccaaatagcgattctgtgaaggagcggctagagctg
gaagtggacatagatgaaaagcaggaaccggtggccaatctcagtgtagatacaatgctg
gacgatgacagtcttagtcccctaagtggcgtagtcaatgagccaatggagtgcagcagc
agtatcgcatcacaggtctctccaagggatgaggaggctattaaagtggtggccgacgat
gttctcatggagtccgttaacgatgtgcatagtatgcatgtggagagtgggacttcgtcg
ccgatctcaaatgcggaaatgcgcgaggaaaatgaagctcagtctgataggactaacgat
aataataccatcgactgcaaaggaataaccgttgacgatttggttctcctctgcgacctg
ttctaccttcccttcgaacatggcagccgcggccacaagcttcttgtggagttcaattgg
ctgaagatcaacgctaatgtgatactgcaggaccgatctgccggcggcggaggcgatgca
atgaaagcagccaagccggaggtcagcgagtggcaccaacgtcgtgagcaattcgaccac
ctctgcagcgccgtcgtagaactgctgattaaaatcgctaactgccagaacaaggagatc
tgtcacgagctgtactcgtatgtgtgggacatatccggcgccctgtctctgctcaactgc
tatgtaaagtggctcgctctcgggaatttcccgcaaaacacgtcttcctacacagagggc
agctacacatggtttagcaagggctggaaggaggcgttcatgtctggtgatcaggagccg
tgggtcttcagaggcggcctcattgcagacctgcaacgcctgatgcctgtggactcgggc
aacgacctgtttgtgtacaagcttccggaacagcccacggccaactactatctcttgaga
ccgtactgtaattcggatgaacagcaggtcaacgatttgtgcactcgcctctacttgcag
tggcagggagagctggacggaggcagccacattccgttcccgctgccggcgaatgtggca
aacatagttgcagatgggatgattggtggacatctcaccctcagtccacaactgtgcatt
gtggcctacgacgagaataacagtatcattggctattcatgcgccgctctggatgtcaac
atatttcgacgcaacctggagatgtgttggtatacggaactacgcgggaaatactctaga
gatgtttgtccacaggagggcggcgaaaaagtgacacagctcgtcacctccttcgtggaa
aactttcatgatagcagcggtaatggagctctggacccgtgtcctgtagaggtgagcggg
tccttccctgccgtgttgatctccggaactctgcgggaggcggaggagcgggacttggga
ataacaaagcggatgctcaccgtactcttggccgccctgcgagcgaatggttgctttggt
gcccacgtacgtgttccccagcaagatgtcgcccaggtgaacttttattctagaatcggt
ttcgtggatgtctatcgtgaggaggccaccaagtgtgtttacatgggtcgccgtttctag

DBGET integrated database retrieval system