KEGG   Drosophila erecta: Dere_GG24489Help
Entry
Dere_GG24489      CDS       T01060                                 

Definition
(RefSeq) GG24489 gene product from transcript GG24489-RA
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dere_GG24489
   00052 Galactose metabolism
    Dere_GG24489
   00500 Starch and sucrose metabolism
    Dere_GG24489
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dere_GG24489
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dere_GG24489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 350 aa AA seqDB search
METIMHFVSEAYNTMLTRELFINEWAQERLSFGKPLWSFFSVQLAPNNMYNFFIPLSGIF
SQEILLHLLSAITLISTLNSFEKWICPETRPLWFLREQFANKKVTKNPKVALESHQLSCE
TTGGLPCAHSMTFTVFVLILASFFFVRCWDRFVSWRSPFCRCIMYMLIMGTVVCMWLSRL
YLATEFLHQCILGSYFGIRALNTFEGNVRYLFSRTRGHAVSVVCFLGGLALSVYFIKLQL
NVDPHWSVREAFKWCPEPAYLRHEACPIFALARDLGNLMGLALASPIYKLEVKQSSFWRR
CRFLGILEFVNYGMRLSTVKQSGRFAFLAYEFTRNAVHALLLIKYLPTFY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagactataatgcactttgtttcggaggcctacaataccatgctcacgcgggagctc
ttcatcaacgaatgggcccaagaacgtttgagttttggaaagcccctttggagttttttt
agcgttcaattggcaccaaacaacatgtacaacttcttcatccccctgagtggcatcttc
agtcaggaaatccttttgcatctcctctcggcgattaccctgatcagcacactgaactcc
ttcgaaaagtggatatgcccggaaacgcgtcctttgtggtttctgcgagagcagtttgcc
aataagaaagtgacgaagaatccgaaggtggccttggaaagtcaccagctgagctgcgag
acgaccggtggcctgccctgcgcccactcgatgaccttcaccgtgttcgtgctcatcctg
gcctcgttcttctttgttcgctgctgggatcgcttcgtgtcctggcgctcgcccttctgc
cgctgcataatgtatatgctgatcatgggaacagtggtctgcatgtggctgagtcgtctc
tacctggccaccgagttcctgcaccagtgcatcctgggcagctactttgggatcagggca
ctcaacaccttcgagggaaatgtgaggtacttgttctcccgcacgcgtggccatgcggtc
tcagtggtttgcttcttgggaggattggcgctgtcggtgtactttataaagctgcaactc
aatgtggatccccattggtctgtgcgcgaggcttttaagtggtgtccagagcccgcatat
ctgcgtcatgaagcttgtccaattttcgcacttgccagggatctgggaaacctaatggga
ctggctctggcttcgccgatatataagctggaagtaaagcaatcatcattttggcggcga
tgccgattcctgggaattctagagtttgtcaactatggaatgcgcctgtccacggtgaag
cagtctggtcgctttgctttcttggcctatgagttcaccagaaatgccgtgcatgcccta
ctactgataaagtaccttccaacattttactag

DBGET integrated database retrieval system